MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint zhang-2010c-1 The APC/C subunit Cdc16/Cut9 is a contiguous tetratricopeptide repeat superhelix with a homo-dimer interface similar to Cdc27. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhang Z., Kulkarni K., Hanrahan SJ., Thompson AJ., Barford D. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation zhang-2010c-2 The APC/C subunit Cdc16/Cut9 is a contiguous tetratricopeptide repeat superhelix with a homo-dimer interface similar to Cdc27. in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Zhang Z., Kulkarni K., Hanrahan SJ., Thompson AJ., Barford D. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation cut9_schpo Anaphase-promoting complex subunit cut9 Cell untimely torn protein 9 cut9 dre1 SPAC6F12.15c 20S cyclosome/APC complex protein cut9 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MVVKRTQTDSRMQSTPGNHNHPDAHANAAYMTPPSMGALNANNSNSQLSTLTISPMTYLANNTSTDGSFLKERNAQNTDSLSREDYLRLWRHDALMQQQYKCAAFVGEKVLDITGNPNDAFWLAQVYCCTGDYARAKCLLTKEDLYNRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGLEKSSDLLLCKADTLFVRSRFIDVLAITTKILEIDPYNLDVYPLHLASLHESGEKNKLYLISNDLVDRHPEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMDPQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQGTHLPYLFLGMQHMQLGNILLANEYLQSSYALFQYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLSTNDANVHTAIALVYLHKKIPGLAITHLHESLAISPNEIMASDLLKRALEENSLTSGFLNSKYVFEDEVSEYMQQSNLNTSDKSMSMEDQSGKVTESVNDRTQVLYADSRSEMMMDDIEGNVSEQR hcn1_schpo Anaphase-promoting complex subunit hcn1 hcn1 SPAC23C11.12 20S cyclosome/APC complex protein hcn1 Chaperone-like protein hcn1 High copy suppressor of cut9 protein 1 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MLRRNPTAIQITAEDVLAYDEEKLRQTLDSESTTEEALQKNEESTRLSPEKKKIIRERRIGITQIFDSSMHPSQGGAAQS cut9-hcn1 1012378 cut9_schpo cut9 1012380 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.2 hcn1_schpo hcn1 1012381 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.2 direct interaction direct interaction false false false F2 mint cut9-hcn1-1 1012379 cut9_schpo cut9 1012380 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.2 hcn1_schpo hcn1 1012381 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.2 direct interaction direct interaction false false false SF1 mint