UniProt UniProt http://www.uniprot.org liang-2011-1 Conversion of D-ribulose 5-phosphate to D-xylulose 5-phosphate: new insights from structural and biochemical studies on human RPE. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Liang W., Ouyang S., Shaw N., Joachimiak A., Zhang R., Liu ZJ. zjliu@ibp.ac.cn FASEB J. (0892-6638) 2011 Only protein-protein interactions imex curation rpe_human Ribulose-phosphate 3-epimerase Ribulose-5-phosphate-3-epimerase RPE HUSSY-17 protein protein human Homo sapiens Human MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR rpe-1 1145813 n/a 1145814 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false R value 0.149 for 3OVP R free 0.174 for 3OVP 1.7 A for 3OVP 1.95 A for 3OVR R value 0.147 for 3OVR R free 0.192 R value 0.149 for 3OVQ R free 0.191 2 A for 3OVQ