IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ shao-2010-1 C. elegans SWAN-1 Binds to EGL-9 and regulates HIF-1-mediated resistance to the bacterial pathogen Pseudomonas aeruginosa PAO1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Shao Z., Zhang Y., Ye Q., Saldanha JN., Powell-Coffman JA. The amino acid numbers for the EGL-9 catalytic domain are not stated in the paper and have been taken from InterPro. japc@iastate.edu PLoS Pathog. (1553-7366) 2010 Only protein-protein interactions imex curation shao-2010-2 C. elegans SWAN-1 Binds to EGL-9 and regulates HIF-1-mediated resistance to the bacterial pathogen Pseudomonas aeruginosa PAO1. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shao Z., Zhang Y., Ye Q., Saldanha JN., Powell-Coffman JA. The amino acid numbers for the EGL-9 catalytic domain are not stated in the paper and have been taken from InterPro. japc@iastate.edu PLoS Pathog. (1553-7366) 2010 Only protein-protein interactions imex curation egl9_caeel Hypoxia-inducible factor prolyl hydroxylase egl-9 Egg-laying defective protein 9 Hypoxia-inducible factor-proline dioxygenase F22E12.4 protein protein caeel Caenorhabditis elegans MSSAPNDDCEIDKGTPSTASLFTTLMLSQPSSSTAVLQCTYCGSSCTSSQLQTCLFCGTVAYCSKEHQQLDWLTHKMICKSLQTSGMVPSNLMPQAAPAVMAPIPPTVSFDDPALTTSLLLSLQNNPILNQTISNFPPTFSITSKTEPEPSIPIQIPQRISSTSTVPFSSEGSAFKPYRNTHVFNSISSESMSSMCTSHEASLEHMSSASLAMFPTSSTAQSDISRLAQVLSLAGDSPASLALVTTSVPSTASTATIPPPATTTSSATSSGKSETITVGKEKIIQTDDPDIQIIETEGGSKPTVSRTRKRPTPSNSADPKINYKDHNKNVVYSTTLQEHQKHLQNRGLALSIHQAMVLRLRYIAEHVIRSLNEFGWAVVDNFLGSDHYKFTAKEIERLYERGLFSPGQLMEAKHKDEFHIKDIRSDHIYWYDGYDGRAKDAATVRLLISMIDSVIQHFKKRIDHDIGGRSRAMLAIYPGNGTRYVKHVDNPVKDGRCITTIYYCNENWDMATDGGTLRLYPETSMTPMDIDPRADRLVFFWSDRRNPHEVMPVFRHRFAITIWYMDKSERDKALAKGKESDAACASKKENDPTSSSLNSLIGSLLRPRKNPSTHDLSKLDLRLFPSTSSDPALVSAADEDRVDISADFQSTSSLAHPESTDSGVSLSTFNVAHNHMERTTSLQSISDHFRSERSHERRSSTSSDQDLDEGLPPPPSTNPEYYI q93758_caeel swan-1 CELE_F53C11.8 F53C11.8 protein protein caeel Caenorhabditis elegans MATNGHAVNGEAHVMQQVAQQPAPPGPLAPQGIGRQNEIVIGGRDRRCEIYKFTSDQQLYASAWSNKNDIKFRLAVGTVSDVSVNPCAANKVSIVQLKDETGELVETASFPMEFPANAVGFIPDPDNVYPDLIATTSDCLRLWRVVDGKVHPDAVMINNTNSQYGSALTSFDWNELEPRYIGVSSVDTTCTIYDVEVGCAIGQTKPTAPFTLKTQLIAHDKPVHDIEFAKINGGRDHFATVGADGSARMFDLRHLNHSTIVYEDPNKEKLQRLSWNKQEPYFMALFAENSQEVQILDIRMPCNILCRLRNHTGPVNGIAWAPHSPHHICTAGDDSQALIWDLQQVPRPVDDPILAYSAGGEVNQIHWGPVHSNWIAICFNKTLEILRV egl_9-swan_1 1016970 n/a 1016972 unspecified role unspecified role bait bait catalytic_domain sufficient to bind sufficient binding region sufficient to bind range range range range false n/a 1016973 unspecified role unspecified role prey prey n-terminal_wd1-3 required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range false physical association physical association false false false Fig 6A,B. swan_1-egl_9 1016971 n/a 1016972 unspecified role unspecified role prey prey catalytic_domain sufficient to bind sufficient binding region sufficient to bind range range range range false region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1016973 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false caeel Caenorhabditis elegans physical association physical association false false false Fig 6C.