DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ fujimoto-2010-2 Arabidopsis dynamin-related proteins DRP2B and DRP1A participate together in clathrin-coated vesicle formation during endocytosis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Fujimoto M., Arimura S., Ueda T., Takanashi H., Hayashi Y., Nakano A., Tsutsumi N. atsutsu@mail.ecc.u-tokyo.ac.jp Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2010 imex curation Only protein-protein interactions fujimoto-2010-1 Arabidopsis dynamin-related proteins DRP2B and DRP1A participate together in clathrin-coated vesicle formation during endocytosis. arath-cell-culture Arabidopsis thaliana cell culture plant_cell_culture plant cellular culture The culture conditions should always be cited in the experimental modifications annotation Either whole plant or undifferentiated plant cells maintained in culture. fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Fujimoto M., Arimura S., Ueda T., Takanashi H., Hayashi Y., Nakano A., Tsutsumi N. atsutsu@mail.ecc.u-tokyo.ac.jp Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2010 imex curation Only protein-protein interactions fujimoto-2010-3 Arabidopsis dynamin-related proteins DRP2B and DRP1A participate together in clathrin-coated vesicle formation during endocytosis. arath-root Arabidopsis thaliana root tissue root In vascular plants, the root is that organ of a plant body that typically lies below the surface of the soil (compare with stem). However, this is not always the case, since a root can also be aerial (that is, growing above the ground) or aerating (that is, growing up above the ground or especially above water). On the other hand, a stem normally occurring below ground is not exceptional either (see rhizome). So, it is better to define root as a part of a plant body that bears no leaves, and therefore also lacks nodes. There are also important internal structural differences between stems and roots. The two major functions of roots are 1) absorption of water and inorganic nutrients and 2) anchoring the plant body to the ground. Roots also function in cytokinin synthesis, which supplies some of shoot needs. They often function in storage of food. fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Fujimoto M., Arimura S., Ueda T., Takanashi H., Hayashi Y., Nakano A., Tsutsumi N. atsutsu@mail.ecc.u-tokyo.ac.jp Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2010 imex curation Only protein-protein interactions drp2b_arath Dynamin-2B DRP2B ADL3 CF1 Dynamin-related protein 2B Dynamin-like protein 3 T30E16.17 At1g59610 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEAIDELSQLSDSMRQAASLLADEDPDETSSSRRPATSLNVVALGNVGAGKSAVLNSLIGHPVLPTGENGATRAPIIIDLSREESLSSKAIILQIDNKNQQVSASALRHSLQDRLSKGASGRGRDEIYLKLRTSTAPPLKLIDLPGLDQRIVDDSMIGEHAQHNDAILLVVVPASQASEISSSRALKIAKEYDPESTRTVGIISKIDQAAENPKSLAAVQALLSNQGPPKTTDIPWVALIGQSVSIASAQSGGSENSLETAWRAESESLKSILTGAPQSKLGRIALVDTLASQIRSRMKLRLPNILTGLQGKSQIVQDELARLGEQLVSSAEGTRAIALELCREFEDKFLLHLAGGEGSGWKVVASFEGNFPNRIKKLPLDRHFDLNNVKRIVLEADGYQPYLISPEKGLRSLIKTVLELAKDPARLCVDEVHRVLVDIVSASANATPGLGRYPPFKREVVAIASAALDGFKNEAKKMVVALVDMERAFVPPQHFIRLVQRRMERQRREEELKGRSSKKGQDAEQSLLNRATSPQPDGPSSTGGSLKSLRDKLMPQDKDKDKEKETPEVSGLKTAGPEGEITAGYLMKKSAKTNGWSRRWFVLNEKTGKLGYTKKQEERNFRGTVTLEECSIEEISDDEGEKSKSSKDKKSNGPDSKGPGLVFKITCRVPYKTVLKAHNALVLKAESMVDKNEWINKLQKVIQARGGQVGSASMRQSLSEGSLDKMVRKPVDPEEELRWMSQEVRGYVEAVLNSLAANVPKAVVLCQVEKSKEDMLNQLYSSISAIGNERIESLIQEDQNVKRRRDRYQKQSSLLSKLTRQLSIHDNRAAAASSWSDNSGTESSPRTNGGSSGEDWMNAFNAAASGPDSLKRYGSGGHSRRYSDPAQNGEDSSGSGGSSRRTTPNRLPPAPPQSGSSYRY drp1a_arath Phragmoplastin DRP1A DRP1A ADL1 ADL1A AG68 Dynamin-like protein 1 Protein RADIAL SWELLING 9 RSW9 MJC20.19 At5g42080 Dynamin-like protein 1A Dynamin-related protein 1A protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MENLISLVNKIQRACTALGDHGDSSALPTLWDSLPAIAVVGGQSSGKSSVLESIVGKDFLPRGSGIVTRRPLVLQLQKIDDGTREYAEFLHLPRKKFTDFAAVRKEIQDETDRETGRSKAISSVPIHLSIYSPNVVNLTLIDLPGLTKVAVDGQSDSIVKDIENMVRSYIEKPNCIILAISPANQDLATSDAIKISREVDPSGDRTFGVLTKIDLMDKGTDAVEILEGRSFKLKYPWVGVVNRSQADINKNVDMIAARKREREYFSNTTEYRHLANKMGSEHLAKMLSKHLERVIKSRIPGIQSLINKTVLELETELSRLGKPIAADAGGKLYSIMEICRLFDQIFKEHLDGVRAGGEKVYNVFDNQLPAALKRLQFDKQLAMDNIRKLVTEADGYQPHLIAPEQGYRRLIESSIVSIRGPAEASVDTVHAILKDLVHKSVNETVELKQYPALRVEVTNAAIESLDKMREGSKKATLQLVDMECSYLTVDFFRKLPQDVEKGGNPTHSIFDRYNDSYLRRIGSNVLSYVNMVCAGLRNSIPKSIVYCQVREAKRSLLDHFFAELGTMDMKRLSSLLNEDPAIMERRSAISKRLELYRAAQSEIDAVAWSK drp3a_arath Dynamin-related protein 3A DRP3A ADL2 ADL2A Dynamin-like protein 2a Dynamin-like protein 2 T16L1.140 At4g33650 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTIEEVSGETPPSTPPSSSTPSPSSSTTNAAPLGSSVIPIVNKLQDIFAQLGSQSTIALPQVVVVGSQSSGKSSVLEALVGRDFLPRGNDICTRRPLVLQLLQTKSRANGGSDDEWGEFRHLPETRFYDFSEIRREIEAETNRLVGENKGVADTQIRLKISSPNVLNITLVDLPGITKVPVGDQPSDIEARIRTMILSYIKQDTCLILAVTPANTDLANSDALQIASIVDPDGHRTIGVITKLDIMDKGTDARKLLLGNVVPLRLGYVGVVNRCQEDILLNRTVKEALLAEEKFFRSHPVYHGLADRLGVPQLAKKLNQILVQHIKVLLPDLKSRISNALVATAKEHQSYGELTESRAGQGALLLNFLSKYCEAYSSLLEGKSEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPRSALFVPDVPFEVLVRRQISRLLDPSLQCARFIFEELIKISHRCMMNELQRFPVLRKRMDEVIGDFLREGLEPSEAMIGDIIDMEMDYINTSHPNFIGGTKAVEAAMHQVKSSRIPHPVARPKDTVEPDRTSSSTSQVKSRSFLGRQANGIVTDQGVVSADAEKAQPAANASDTRWGIPSIFRGGDTRAVTKDSLLNKPFSEAVEDMSHNLSMIYLKEPPAVLRPTETHSEQEAVEIQITKLLLRSYYDIVRKNIEDSVPKAIMHFLVNHTKRELHNVFIKKLYRENLFEEMLQEPDEIAVKRKRTQETLHVLQQAYRTLDELPLEADSVSAGMSKHQELLTSSKYSTSSSYSASPSTTRRSRRAGDQHQNGYGF clc2_arath Clathrin light chain 2 At2g40060 CLC2 T28M21.22 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSAFEDDSFVILNDDASESVPVSGSFDATDSFSAFDGSLQVEDSVDDVFAAPSSDYGAYSNGDGIFGSNGDHDGPILPPPSEMESDEGFALREWRRQNAIQLEEKEKREKELLKQIIEEADQYKEEFHKKIEVTCENNKAANREKEKLYLENQEKFYAESSKNYWKAIAELVPKEVPTIEKRRGKKEQQDPKKPTVSVIQGPKPGKPTDLTRMRQILVKLKHNPPSHLKLTSQPPSEEAAAPPKNVPETKPTEAVTAA drp1a-drp2b-2 1184446 n/a 1184449 unspecified role unspecified role prey prey n/a 1184450 unspecified role unspecified role bait bait physical association physical association false false false Fig. 6B drp2b-drp1a-1 1184446 n/a 1184449 unspecified role unspecified role bait bait n/a 1184450 unspecified role unspecified role prey prey physical association physical association false false false Fig. 6B drp1a-drp1a-1 1184446 n/a 1184450 unspecified role unspecified role prey prey n/a 1184450 unspecified role unspecified role bait bait physical association physical association false false false Fig. 6B drp3a-drp3a-1 1184446 n/a 1184451 unspecified role unspecified role prey prey n/a 1184451 unspecified role unspecified role bait bait physical association physical association false false false Fig. 6B drp1a-o04209 1184447 n/a 1184452 unspecified role unspecified role neutral component neutral component region fluorescent prot tag fluorescent protein tag fluorescent prot tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1184450 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 2B, 3D drp2b-o04209 1184447 n/a 1184449 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1184452 unspecified role unspecified role neutral component neutral component region fluorescent prot tag fluorescent protein tag fluorescent prot tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 2A, 3C drp1a-drp2b-4 1184447 n/a 1184449 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1184450 unspecified role unspecified role neutral component neutral component region fluorescent prot tag fluorescent protein tag fluorescent prot tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 4 drp1a-drp2b-5 1184448 n/a 1184450 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1184449 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 5