MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint xiao-2010-2 Protein phosphatase-1 regulates Akt1 signal transduction pathway to control gene expression, cell survival and differentiation. human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Xiao L., Gong LL., Yuan D., Deng M., Zeng XM., Chen LL., Zhang L., Yan Q., Liu JP., Hu XH., Sun SM., Liu J., Ma HL., Zheng CB., Fu H., Chen PC., Zhao JQ., Xie SS., Zou LJ., Xiao YM., Liu WB., Zhang J., Liu Y., Li DW. Cell Death Differ. (1350-9047) 2010 partial coverage rapid curation rapid curation xiao-2010-1 Protein phosphatase-1 regulates Akt1 signal transduction pathway to control gene expression, cell survival and differentiation. in vitro In vitro phosphatase assay phosphatase assay predetermined predetermined participant predetermined Xiao L., Gong LL., Yuan D., Deng M., Zeng XM., Chen LL., Zhang L., Yan Q., Liu JP., Hu XH., Sun SM., Liu J., Ma HL., Zheng CB., Fu H., Chen PC., Zhao JQ., Xie SS., Zou LJ., Xiao YM., Liu WB., Zhang J., Liu Y., Li DW. Cell Death Differ. (1350-9047) 2010 partial coverage rapid curation rapid curation xiao-2010-3 Protein phosphatase-1 regulates Akt1 signal transduction pathway to control gene expression, cell survival and differentiation. human Homo sapiens Human fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Xiao L., Gong LL., Yuan D., Deng M., Zeng XM., Chen LL., Zhang L., Yan Q., Liu JP., Hu XH., Sun SM., Liu J., Ma HL., Zheng CB., Fu H., Chen PC., Zhao JQ., Xie SS., Zou LJ., Xiao YM., Liu WB., Zhang J., Liu Y., Li DW. Cell Death Differ. (1350-9047) 2010 partial coverage rapid curation rapid curation pp1a_human Serine/threonine-protein phosphatase PP1-alpha catalytic subunit PPP1CA PPP1A protein protein human Homo sapiens Human MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK akt1_human RAC-alpha serine/threonine-protein kinase AKT1 PKB RAC RAC-PK-alpha Protein kinase B Proto-oncogene c-Akt Protein kinase B alpha protein protein human Homo sapiens Human MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA ppp1ca-akt1 1240551 pp1a_human 1240554 unspecified role unspecified role bait bait akt1_human 1240555 unspecified role unspecified role prey prey physical association physical association false false false homomint mint f3a f3b akt1-ppp1ca-1 1240551 pp1a_human 1240554 unspecified role unspecified role prey prey akt1_human 1240555 unspecified role unspecified role bait bait physical association physical association false false false homomint mint f3a f3b akt1-ppp1ca 1240552 pp1a_human 1240554 enzyme enzyme neutral component neutral component akt1_human 1240555 enzyme target enzyme target substrate substrate neutral component neutral component phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm dephosphorylation dephosphorylation reaction dephosphorylation false false false f2c homomint mint akt1-ppp1ca-2 1240553 pp1a_human 1240554 unspecified role unspecified role unspecified role unspecified role akt1_human 1240555 unspecified role unspecified role unspecified role unspecified role colocalization colocalization false false false homomint mint f3f f3j