UniProt UniProt http://www.uniprot.org ellisdon-2010-2 Structural basis for the interaction between yeast Spt-Ada-Gcn5 acetyltransferase (SAGA) complex components Sgf11 and Sus1. ecoli Escherichia coli (strain K12) pull down pull down weight by staining molecular weight estimation by staining weight by staining Ellisdon AM., Jani D., Kohler A., Hurt E., Stewart M. ms@mrc-lmb.cam.ac.uk J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation ellisdon-2010-1 Structural basis for the interaction between yeast Spt-Ada-Gcn5 acetyltransferase (SAGA) complex components Sgf11 and Sus1. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ellisdon AM., Jani D., Kohler A., Hurt E., Stewart M. ms@mrc-lmb.cam.ac.uk J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation ellisdon-2010-3 Structural basis for the interaction between yeast Spt-Ada-Gcn5 acetyltransferase (SAGA) complex components Sgf11 and Sus1. in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Ellisdon AM., Jani D., Kohler A., Hurt E., Stewart M. ms@mrc-lmb.cam.ac.uk J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation sgf11_yeast SAGA-associated factor 11 SGF11 11 kDa SAGA-associated factor YPL047W protein protein yeast Saccharomyces cerevisiae Baker's yeast MTEETITIDSISNGILNNLLTTLIQDIVARETTQQQLLKTRYPDLRSYYFDPNGSLDINGLQKQQESSQYIHCENCGRDVSANRLAAHLQRCLSRGARR 31CBBD4CAA18F3F9 sus1_yeast Transcription and mRNA export factor SUS1 SUS1 YBR111W-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MTMDTAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESTNFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEIVDTQ DB0DA0C9DC13FB21 sac3_yeast Nuclear mRNA export protein SAC3 SAC3 LEP1 YDR159W YD8358.13 Leucine permease transcriptional regulator protein protein yeast Saccharomyces cerevisiae Baker's yeast MNTSFGSVVPSTNFNFFKGHGNNDNTSANSTVNNSNFFLNSNETKPSKNVFMVHSTSQKKSQQPLQNLSHSPSYTENKPDKKKKYMINDAKTIQLVGPLISSPDNLGFQKRSHKARELPRFLINQEPQLEKRAFVQDPWDKANQEKMISLEESIDDLNELYETLKKMRNTERSIMEEKGLVDKADSAKDLYDAIVFQGTCLDMCPTFERSRRNVEYTVYSYEKNQPNDKKASRTKALKVFARPAAAAAPPLPSDVRPPHILVKTLDYIVDNLLTTLPESEGFLWDRMRSIRQDFTYQNYSGPEAVDCNERIVRIHLLILHIMVKSNVEFSLQQELEQLHKSLITLSEIYDDVRSSGGTCPNEAEFRAYALLSKIRDPQYDENIQRLPKHIFQDKLVQMALCFRRVISNSAYTERGFVKTENCLNFYARFFQLMQSPSLPLLMGFFLQMHLTDIRFYALRALSHTLNKKHKPIPFIYLENMLLFNNRQEIIEFCNYYSIEIINGDAADLKTLQHYSHKLSETQPLKKTYLTCLERRLQKTTYKGLINGGEDNLASSVYVKDPKKDRIPSIADQSFLMENFQNNYNEKLNQNSSVKPQINTSPKRVATRPNHFPFSQESKQLPQISQSHTLSTNPLLTPQVHGDLSEQKQQQIKTVTDGGSPFVFDQSAQNSTVEASKAHMISTTSNGAYDEKLSSEQEEMRKKEEQRIEEEKTQLKKKQENADKQVITEQIANDLVKEVVNSSVISIVKREFSEANYRKDFIDTMTRELYDAFLHERLYLIYMDSRAELKRNSTLKKKFFEKWQASYSQAKKNRILEEKKREEIKLVSHQLGVPGFKKSTCLFRTPYKGNVNSSFMLSSSDKNLIFSPVNDEFNKFATHLTKISKLWRPLEMQSIYYDNLTKKFPSNSLTPANLFIYAKDWTSLSNRWILSKFNLQTAQDSKKFSNNIISSRIICIDDEYEPSDFSDLQLLIFNTGVTNPDIFDLEMKLKDDGEELIKLITGISLNTNICFSLLIIYWESAENTLSESTIKHLLKLNRISKNYSSVIERIDLMNLTEESPHKCLEDKLSEISHSYVYKLTERGKYDKTLRQKRSLAGIHSRSTQLQTTKDIDQKMKKMLEKEKNKYQQQIGERNTYAHLESHIDASPRSKKRKLPILLSTSHSSQFKTPLASRLNTSGSSTSPPLPSHLAMKFRKNSRVTSLHTVLPVSTPSHSNNIPAASFSGNNTTDIQSQQLIENQKSTSVYLNNVSERILGNQEICQTPINPVTPVLDGADQGKEDIPDSILELKILIDSVKKKVNND 0679DB1673DDACEB cdc31_yeast Cell division control protein 31 YOR257W CDC31 DSK1 Nucleoporin CDC31 Nuclear pore protein CDC31 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKNRSSLQSGPLNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS 25A546E76E1EF520 sgf11-sus1-1 1022278 n/a 1022281 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind protein staining protein staining certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q03067:p.Asn18Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain false Q03067:p.Leu19Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain false Q03067:p.Ile15Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1022282 unspecified role unspecified role prey prey physical association physical association false false false fig 1, fig 5 sac3-cdc31-8 1022278 n/a 1022283 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind protein staining protein staining certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1022284 unspecified role unspecified role prey prey physical association physical association false false false fig 6 sgf11-sus1-2 1022279 n/a 1022281 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1022282 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false 2.1 A R-value 0.197 R-free 0.231 sac3-cdc31-7 1022280 n/a 1022282 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1022284 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1022283 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind protein staining protein staining certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false fig 6