UniProt UniProt http://www.uniprot.org gray-2009-1 The planar cell polarity effector Fuz is essential for targeted membrane trafficking, ciliogenesis and mouse embryonic development. xenla Xenopus laevis (African clawed frog) African clawed frog anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Gray RS., Abitua PB., Wlodarczyk BJ., Szabo-Rogers HL., Blanchard O., Lee I., Weiss GS., Liu KJ., Marcotte EM., Wallingford JB., Finnell RH. wallingford@mail.utexas.edu, rfinnell@ibt.tamhsc.edu Nat. Cell Biol. (1465-7392) 2009 mimix curation cpln2_xenla Ciliogenesis and planar polarity effector 2 cplane2 REM2- and Rab-like small GTPase 1 rsg1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSVTPVLDPEWQRSPEGLDYLSRVLRHNKRKFFGLIERPVLPPHLPADVAAYKVFVCGKSGVGKTSFIAKLSGLAVPSMHHETAGIQTTCMYWPVRPSGSARPVIFRFQFWDCGEGALRKFDHILPACKEKADAVLFLFSFTDRSSFEDVPALISRTLDQDEDVTRVVIGTKLDQYMHTDVTEDDLRDFQRTWQLPVMRVRSVNGPRMTDGRDLDGRAGLAECAPVLNGLAEILWHRDQVIAGLVGGAE fuzzy_xentr Protein fuzzy homolog fuz fuzzy fy Xfy protein protein xentr Xenopus tropicalis (Western clawed frog) Silurana tropicalis MEDSSVFLLCLAASSGVPLYSRSKGSSRQLTFSVIGSLNGVHMFASNQDVLLTSTCTENTRVAWRAFHDSITLIVMSSESGASKLSLNRLLENVFNAMVLVIGLDDLVNIKNVERLKKDLRACYRLIDSFLLETEKMGDLTQCVDCVIAYDVPILQECLDNFTQAAESNFGCLMAGGKVVVATEKWWRLSSQEVMLLCWLVASLAPHSSRDYPVYLPQGSPTVPHRLLTFQLVPGVDVCVLCGPKPSLQKVETELIERFWKPVHDPIKSCLRVQMRSFPASVPLHHGILGLLLINRDMNKSLYTVQAHPMEEMQKTDLKLTLEQRRSALRSFYTLAMSRYFPSERADGKNTLPSEESFQSGFSHSAHQCYTISSSCKCYGMKTELHLLFLLLKPEVPTFSMRSIANKTIAAFTKDFPF fuzzy-rsg1 1136294 n/a 1136295 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1136296 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S2B