UniProt UniProt http://www.uniprot.org cho-2009a-3 Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cho H., Kim KM., Kim YK. yk-kim@korea.ac.kr human thymus cDNA library Mol. Cell (1097-2765) 2009 mimix curation cho-2009a-6 Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Cho H., Kim KM., Kim YK. yk-kim@korea.ac.kr human thymus cDNA library Mol. Cell (1097-2765) 2009 mimix curation cho-2009a-1 Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Cho H., Kim KM., Kim YK. yk-kim@korea.ac.kr human thymus cDNA library Mol. Cell (1097-2765) 2009 mimix curation cho-2009a-10 Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Cho H., Kim KM., Kim YK. yk-kim@korea.ac.kr human thymus cDNA library Mol. Cell (1097-2765) 2009 mimix curation cho-2009a-7 Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cho H., Kim KM., Kim YK. (Fig S5) Transfected myc-tagged PNRC2 was detected by using an anti-myc antibody and endogenous DCP1A was detected using an anti-DCP1A antibody. yk-kim@korea.ac.kr human thymus cDNA library Mol. Cell (1097-2765) 2009 mimix curation cho-2009a-2 Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Cho H., Kim KM., Kim YK. FLAG-Upf1 is shown to be human in Kim-2005 et al. FLAG-hDcp1a (gift from Lykke-Anderson) has been entered as human with reference to Lykke-Anderson et al, Mol. and Cell Biology 2002. This has not been confrimed by the authors. yk-kim@korea.ac.kr human thymus cDNA library Mol. Cell (1097-2765) 2009 mimix curation cho-2009a-4 Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Cho H., Kim KM., Kim YK. yk-kim@korea.ac.kr human thymus cDNA library Mol. Cell (1097-2765) 2009 mimix curation cho-2009a-5 Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Cho H., Kim KM., Kim YK. yk-kim@korea.ac.kr human thymus cDNA library Mol. Cell (1097-2765) 2009 mimix curation cho-2009a-9 Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Cho H., Kim KM., Kim YK. yk-kim@korea.ac.kr human thymus cDNA library Mol. Cell (1097-2765) 2009 mimix curation rent1_human Regulator of nonsense transcripts 1 UPF1 RENT1 KIAA0221 ATP-dependent helicase RENT1 Nonsense mRNA reducing factor 1 Up-frameshift suppressor 1 homolog protein protein human Homo sapiens Human MSVEAYGPSSQTLTFLDTEEAELLGADTQGSEFEFTDFTLPSQTQTPPGGPGGPGGGGAGGPGGAGAGAAAGQLDAQVGPEGILQNGAVDDSVAKTSQLLAELNFEEDEEDTYYTKDLPIHACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLVRAKCKEVTLHKDGPLGETVLECYNCGCRNVFLLGFIPAKADSVVVLLCRQPCASQSSLKDINWDSSQWQPLIQDRCFLSWLVKIPSEQEQLRARQITAQQINKLEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTDSGNEDLVIIWLRDMRLMQGDEICLRYKGDLAPLWKGIGHVIKVPDNYGDEIAIELRSSVGAPVEVTHNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSSADEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLGAKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIRLQVQYRMHPALSAFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQPDKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVEGPLNNLRESLMQFSKPRKLVNTINPGARFMTTAMYDAREAIIPGSVYDRSSQGRPSSMYFQTHDQIGMISAGPSHVAAMNIPIPFNLVMPPMPPPGYFGQANGPAAGRGTPKGKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQGYISMSQPSQMSQPGLSQPELSQDSYLGDEFKSQIDVALSQDSTYQGERAYQHGGVTGLSQY pnrc2_human Proline-rich nuclear receptor coactivator 2 PNRC2 HSPC208 protein protein human Homo sapiens Human MGGGERYNIPAPQSRNVSKNQQQLNRQKTKEQNSQMKIVHKKKERGHGYNSSAAAWQAMQNGGKNKNFPNNQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFNPSDKEIMTFQLKTLLKVQV dcp1a_human mRNA-decapping enzyme 1A DCP1A Transcription factor SMIF Smad4-interacting transcriptional co-activator SMIF protein protein human Homo sapiens Human MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPRQRSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVASFSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSAIPVAGAPLVTATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL ddx6_human Probable ATP-dependent RNA helicase DDX6 DDX6 HLR2 RCK DEAD box protein 6 ATP-dependent RNA helicase p54 Oncogene RCK protein protein human Homo sapiens Human MSTARTENPVIMGLSSQNGQLRGPVKPTGGPGGGGTQTQQQMNQLKNTNTINNGTQQQAQSMTTTIKPGDDWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEYHSEPVEDEKP pnrc1_human Proline-rich nuclear receptor coactivator 1 PROL2 Proline-rich protein 2 Protein B4-2 PNRC1 protein protein human Homo sapiens Human MTVVSVPQREPLVLGGRLAPLGFSSRGYFGALPMVTTAPPPLPRIPDPRALPPTLFLPHFLGGDGPCLTPQPRAPAALPNRSLAVAGGTPRAAPKKRRKKKVRASPAGQLPSRFHQYQQHRPSLEGGRSPATGPSGAQEVPGPAAALAPSPAAAAGTEGASPDLAPLRPAAPGQTPLRKEVLKSKMGKSEKIALPHGQLVHGIHLYEQPKINRQKSKYNLPLTKITSAKRNENNFWQDSVSSDRIQKQEKKPFKNTENIKNSHLKKSAFLTEVSQKENYAGAKFSDPPSPSVLPKPPSHWMGSTVENSNQNRELMAVHLKTLLKVQT rent2_human Regulator of nonsense transcripts 2 Nonsense mRNA reducing factor 2 Up-frameshift suppressor 2 homolog UPF2 KIAA1408 RENT2 protein protein human Homo sapiens Human MPAERKKPASMEEKDSLPNNKEKDCSERRTVSSKERPKDDIKLTAKKEVSKAPEDKKKRLEDDKRKKEDKERKKKDEEKVKAEEESKKKEEEEKKKHQEEERKKQEEQAKRQQEEEAAAQMKEKEESIQLHQEAWERHHLRKELRSKNQNAPDSRPEENFFSRLDSSLKKNTAFVKKLKTITEQQRDSLSHDFNGLNLSKYIAEAVASIVEAKLKISDVNCAVHLCSLFHQRYADFAPSLLQVWKKHFEARKEEKTPNITKLRTDLRFIAELTIVGIFTDKEGLSLIYEQLKNIINADRESHTHVSVVISFCRHCGDDIAGLVPRKVKSAAEKFNLSFPPSEIISPEKQQPFQNLLKEYFTSLTKHLKRDHRELQNTERQNRRILHSKGELSEDRHKQYEEFAMSYQKLLANSQSLADLLDENMPDLPQDKPTPEEHGPGIDIFTPGKPGEYDLEGGIWEDEDARNFYENLIDLKAFVPAILFKDNEKSCQNKESNKDDTKEAKESKENKEVSSPDDLELELENLEINDDTLELEGGDEAEDLTKKLLDEQEQEDEEASTGSHLKLIVDAFLQQLPNCVNRDLIDKAAMDFCMNMNTKANRKKLVRALFIVPRQRLDLLPFYARLVATLHPCMSDVAEDLCSMLRGDFRFHVRKKDQINIETKNKTVRFIGELTKFKMFTKNDTLHCLKMLLSDFSHHHIEMACTLLETCGRFLFRSPESHLRTSVLLEQMMRKKQAMHLDARYVTMVENAYYYCNPPPAEKTVKKKRPPLQEYVRKLLYKDLSKVTTEKVLRQMRKLPWQDQEVKDYVICCMINIWNVKYNSIHCVANLLAGLVLYQEDVGIHVVDGVLEDIRLGMEVNQPKFNQRRISSAKFLGELYNYRMVESAVIFRTLYSFTSFGVNPDGSPSSLDPPEHLFRIRLVCTILDTCGQYFDRGSSKRKLDCFLVYFQRYVWWKKSLEVWTKDHPFPIDIDYMISDTLELLRPKIKLCNSLEESIRQVQDLEREFLIKLGLVNDKDSKDSMTEGENLEEDEEEEEGGAETEEQSGNESEVNEPEEEEGSDNDDDEGEEEEEENTDYLTDSNKENETDEENTEVMIKGGGLKHVPCVEDEDFIQALDKMMLENLQQRSGESVKVHQLDVAIPLHLKSQLRKGPPLGGGEGEAESADTMPFVMLTRKGNKQQFKILNVPMSSQLAANHWNQQQAEQEERMRMKKLTLDINERQEQEDYQEMLQSLAQRPAPANTNRERRPRYQHPKGAPNADLIFKTGGRRR upf1-pnrc2-1 1145375 n/a 1145384 unspecified role unspecified role bait bait n/a 1145385 unspecified role unspecified role prey prey physical association physical association false false false 1c pnrc2-dcp1a 1145375 n/a 1145386 unspecified role unspecified role prey prey n/a 1145385 unspecified role unspecified role bait bait n/a 1145384 unspecified role unspecified role prey prey association association false false false 1d upf1-dcp1a-7 1145375 n/a 1145386 unspecified role unspecified role prey prey n/a 1145384 unspecified role unspecified role bait bait association association false false false 5a dcp1a-pnrc2 1145375 n/a 1145384 unspecified role unspecified role prey prey n/a 1145386 unspecified role unspecified role bait bait n/a 1145385 unspecified role unspecified role prey prey association association false false false 2b dcp1a-pnrc2-1 1145376 n/a 1145386 unspecified role unspecified role neutral component neutral component n/a 1145385 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 3f ddx6-pnrc2 1145376 n/a 1145385 unspecified role unspecified role neutral component neutral component n/a 1145387 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 3g dcp1a-upf1-1 1145376 n/a 1145384 unspecified role unspecified role neutral component neutral component n/a 1145386 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 5C/D, 6C/D, S6D A mutant form of RENT1/Upf1 representing a hyperphosphorylated form has been used. In contrast, unmodified RENT1/UPF1 is evenly distributed in the cytoplasm. ddx6-upf1 1145376 n/a 1145387 unspecified role unspecified role neutral component neutral component n/a 1145384 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false S6B A mutant form of RENT1/Upf1 representing a hyperphosphorylated form has been used. In contrast, unmodified RENT1/UPF1 is evenly distributed in the cytoplasm. upf1-pnrc2 1145377 n/a 1145384 unspecified role unspecified role bait bait n/a 1145385 unspecified role unspecified role prey prey physical association physical association false false false upf1-pnrc1 1145377 n/a 1145388 unspecified role unspecified role prey prey n/a 1145384 unspecified role unspecified role bait bait physical association physical association false false false upf1-upf2-1 1145377 n/a 1145384 unspecified role unspecified role bait bait n/a 1145389 unspecified role unspecified role prey prey physical association physical association false false false upf1-pnrc2-5 1145378 n/a 1145385 unspecified role unspecified role prey prey n/a 1145384 unspecified role unspecified role bait bait physical association physical association false false false 1a upf1-pnrc1-1 1145378 n/a 1145388 unspecified role unspecified role prey prey n/a 1145384 unspecified role unspecified role bait bait physical association physical association false false false 1a upf1-upf2-2 1145378 n/a 1145384 unspecified role unspecified role bait bait n/a 1145389 unspecified role unspecified role prey prey physical association physical association false false false 1a dcp1a-upf1-2 1145379 n/a 1145386 unspecified role unspecified role bait bait n/a 1145384 unspecified role unspecified role prey prey physical association physical association false false false 6e upf1-dcp1a-6 1145379 n/a 1145386 unspecified role unspecified role prey prey n/a 1145385 unspecified role unspecified role prey prey n/a 1145384 unspecified role unspecified role bait bait association association false false false S5 upf1-dcp1a-9 1145380 n/a 1145385 unspecified role unspecified role prey prey n/a 1145384 unspecified role unspecified role bait bait association association false false false 5a pnrc2-upf1 1145381 n/a 1145385 unspecified role unspecified role bait bait n/a 1145384 unspecified role unspecified role prey prey physical association physical association false false false 2c upf1-pnrc2-3 1145382 n/a 1145384 unspecified role unspecified role bait bait n/a 1145385 unspecified role unspecified role prey prey physical association physical association false false false 2a upf1-pnrc2-2 1145383 n/a 1145384 unspecified role unspecified role bait bait n/a 1145385 unspecified role unspecified role prey prey physical association physical association false false false 1e