UniProt UniProt http://www.uniprot.org konopka-2008-1 Dynamics of Arabidopsis dynamin-related protein 1C and a clathrin light chain at the plasma membrane. arath-root Arabidopsis thaliana root tissue root In vascular plants, the root is that organ of a plant body that typically lies below the surface of the soil (compare with stem). However, this is not always the case, since a root can also be aerial (that is, growing above the ground) or aerating (that is, growing up above the ground or especially above water). On the other hand, a stem normally occurring below ground is not exceptional either (see rhizome). So, it is better to define root as a part of a plant body that bears no leaves, and therefore also lacks nodes. There are also important internal structural differences between stems and roots. The two major functions of roots are 1) absorption of water and inorganic nutrients and 2) anchoring the plant body to the ground. Roots also function in cytokinin synthesis, which supplies some of shoot needs. They often function in storage of food. fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Konopka C.A., Backues S.K., Bednarek S.Y. sybednar@wisc.edu Plant Cell (1040-4651) 2008 Only protein-protein interactions imex curation drp1c_arath Phragmoplastin DRP1C DRP1C ADL1C ADL5 DLP1 Dynamin-like protein 5 Dynamin-like protein DLP1 Dynamin-like protein 1C Dynamin-related protein 1C F10B6.23 At1g14830 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATMKSLIGLINKIQRACTVLGDHGGEGMSLWEALPTVAVVGGQSSGKSSVLESVVGRDFLPRGSGIVTRRPLVLQLHKTEDGTTEYAEFLHAPKKRFADFAAVRKEIEDETDRITGKSKQISNIPIQLSIYSPNVVNLTLIDLPGLTKVAVDGQPESIVQDIENMVRSYVEKPNCIILAISPANQDIATSDAIKLAREVDPTGERTFGVATKLDIMDKGTDCLDVLEGRSYRLQHPWVGIVNRSQADINKRVDMIAARRKEQEYFETSPEYGHLASRMGSEYLAKLLSQHLETVIRQKIPSIVALINKSIDEINAELDRIGRPIAVDSGAQLYTILELCRAFDRVFKEHLDGGRPGGDRIYGVFDHQLPAALKKLPFDRHLSTKNVQKVVSEADGYQPHLIAPEQGYRRLIDGSISYFKGPAEATVDAVHFVLKELVRKSISETEELKRFPTLASDIAAAANEALERFRDESRKTVLRLVDMESSYLTVEFFRKLHLEPEKEKPNPRNAPAPNADPYSDNHFRKIGSNVSAYINMVCDTLRNSLPKAVVYCQVREAKRSLLNFFYAQVGRKEKEKLGAMLDEDPQLMERRGTLAKRLELYKQARDDIDAVAWK clc2_arath Clathrin light chain 2 At2g40060 CLC2 T28M21.22 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSAFEDDSFVILNDDASESVPVSGSFDATDSFSAFDGSLQVEDSVDDVFAAPSSDYGAYSNGDGIFGSNGDHDGPILPPPSEMESDEGFALREWRRQNAIQLEEKEKREKELLKQIIEEADQYKEEFHKKIEVTCENNKAANREKEKLYLENQEKFYAESSKNYWKAIAELVPKEVPTIEKRRGKKEQQDPKKPTVSVIQGPKPGKPTDLTRMRQILVKLKHNPPSHLKLTSQPPSEEAAAPPKNVPETKPTEAVTAA drp1c-o04209 1186956 n/a 1186957 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1186958 unspecified role unspecified role neutral component neutral component region fluorescent prot tag fluorescent protein tag fluorescent prot tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 8