UniProt UniProt http://www.uniprot.org mitrovic-2008-3 The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi. human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mitrovic S., Ben-Tekaya H., Koegler E., Gruenberg J., Hauri H.P. Origin of HA-tagged SURF4 taken from PMID:15308636 hans-peter.hauri@unibas.ch Mol. Biol. Cell (1059-1524) 2008 mimix curation mitrovic-2008-1 The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Mitrovic S., Ben-Tekaya H., Koegler E., Gruenberg J., Hauri H.P. hans-peter.hauri@unibas.ch Mol. Biol. Cell (1059-1524) 2008 mimix curation mitrovic-2008-2 The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi. human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). bn-page blue native page bn-page ms participant Identification by mass spectrometry ms participant Mitrovic S., Ben-Tekaya H., Koegler E., Gruenberg J., Hauri H.P. Two dimensional gel electrophoresis on Surf4 protein complexes from ERGIC fractions. Origin of HA-tagged SURF4 taken from PMID:15308636 hans-peter.hauri@unibas.ch Mol. Biol. Cell (1059-1524) 2008 mimix curation mitrovic-2008-4 The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi. human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Mitrovic S., Ben-Tekaya H., Koegler E., Gruenberg J., Hauri H.P. Origin of HA-tagged SURF4 taken from PMID:15308636 hans-peter.hauri@unibas.ch Mol. Biol. Cell (1059-1524) 2008 mimix curation mitrovic-2008-5 The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi. human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Mitrovic S., Ben-Tekaya H., Koegler E., Gruenberg J., Hauri H.P. Origin of HA-tagged SURF4 taken from PMID:15308636 hans-peter.hauri@unibas.ch Mol. Biol. Cell (1059-1524) 2008 mimix curation tmeda_human Transmembrane emp24 domain-containing protein 10 21 kDa transmembrane-trafficking protein Transmembrane protein Tmp21 Tmp-21-I p24delta S31III125 TMED10 TMP21 p23 p24 family protein delta-1 S31I125 protein protein human Homo sapiens Human MSGLSGPPARRGPFPLALLLLFLLGPRLVLAISFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGLRSHLKITDSAGHILYSKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPDQLVILDMKHGVEAKNYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMFCLIGLATWQVFYLRRFFKAKKLIE tmed2_human Transmembrane emp24 domain-containing protein 2 TMED2 RNP24 Membrane protein p24A p24 family protein beta-1 p24 protein protein human Homo sapiens Human MVTLAELLVLLAALLATVSGYFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAMTLGQIYYLKRFFEVRRVV surf4_human Surfeit locus protein 4 SURF4 SURF-4 protein protein human Homo sapiens Human MGQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWNCGYLLASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRNLALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFFSIVQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFLKYDFFQTMSVIGGLLLVVALGPGGVSMDEKKKEW lman1_human Protein ERGIC-53 LMAN1 ERGIC53 F5F8D ER-Golgi intermediate compartment 53 kDa protein Lectin mannose-binding 1 Gp58 Intracellular mannose-specific lectin MR60 protein protein human Homo sapiens Human MAGSRQRGLRARVRPLFCALLLSLGRFVRGDGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGMQHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVHFIIFVVVQTVLFIGYIMYRSQQEAAAKKFF tmed7_human Transmembrane emp24 domain-containing protein 7 TMED7 CGI-109 p24 family protein gamma-3 p27 protein protein human Homo sapiens Human MPRPGSAQRWAAVAGRWGCRLLALLLLVPGPGGASEITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSENRVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSVGEALILLVVSIGQVFLLKSFFSDKRTTTTRVGS tmed9_human Transmembrane emp24 domain-containing protein 9 TMED9 GP25L2 Glycoprotein 25L2 p25 p24 family protein alpha-2 GMP25 protein protein human Homo sapiens Human MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRHLKSFFEAKKLV tmed10-surf4 1170859 n/a 1170864 unspecified role unspecified role bait bait n/a 1170865 unspecified role unspecified role prey prey n/a 1170866 unspecified role unspecified role prey prey association association false false false 2c SURF4 has been detected by ant-HA antiobody tmed10-tmed2-1 1170859 n/a 1170866 unspecified role unspecified role prey prey n/a 1170865 unspecified role unspecified role bait bait n/a 1170864 unspecified role unspecified role prey prey association association false false false 2c SURF4 has been detected by ant-HA antiobody lman1-surf4-4 1170859 n/a 1170867 unspecified role unspecified role bait bait n/a 1170866 unspecified role unspecified role prey prey physical association physical association false false false 2D lman1-surf4 1170860 n/a 1170867 unspecified role unspecified role neutral component neutral component n/a 1170866 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 1 surf4-tmed10 1170861 n/a 1170866 unspecified role unspecified role neutral component neutral component n/a 1170868 unspecified role unspecified role neutral component neutral component n/a 1170869 unspecified role unspecified role neutral component neutral component n/a 1170865 unspecified role unspecified role neutral component neutral component n/a 1170864 unspecified role unspecified role neutral component neutral component physical association physical association false false false 2B KDEL-receptor has also been identified but could be differentiated between KDELR1 AC:P24390 or KDELR2 AC:P33947 surf4-tmed10-1 1170862 n/a 1170866 unspecified role unspecified role bait bait n/a 1170865 unspecified role unspecified role prey prey n/a 1170864 unspecified role unspecified role prey prey association association false false false 2c lman1-surf4-3 1170863 n/a 1170867 unspecified role unspecified role bait bait n/a 1170866 unspecified role unspecified role prey prey physical association physical association false false false 2c