UniProt UniProt http://www.uniprot.org gupta-2006-6 Evidence for a role of transmembrane protein p25 in localization of protein tyrosine phosphatase TC48 to the ER. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gupta V., Swarup G. This experiment relates to a negative interaction Experiments showing endogenous COS1 proteins are not included as proteins are not available (fig 6A and D, 8A and B). Origin of VSVG-GFP according pmid 9288971, origin of myc-tagged p24 proteins according pmid 10852829. gshyam@ccmb.res.in J. Cell. Sci. (0021-9533) 2006 mimix curation p17706-2 Tyrosine-protein phosphatase non-receptor type 2 PTPN2 PTPT T-cell protein-tyrosine phosphatase p45TC TC45 PTPA TC-PTPa protein protein human Homo sapiens Human MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQNAENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKESVKCAQYWPTDDQEMLFKETGFSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGDDINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKRWKELSKEDLSPAFDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKATTAQKVQQMKQRLNENERKRKRPRLTDT Major isoform. Contains a phosphoserine at position 304. Contains a nuclear location signal at positions 377-381 (Ref.8) and an autoinhibitory region acting through intramolecular interactions is found at positions 353-387. tmed9_human Transmembrane emp24 domain-containing protein 9 TMED9 GP25L2 Glycoprotein 25L2 p25 p24 family protein alpha-2 GMP25 protein protein human Homo sapiens Human MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRHLKSFFEAKKLV tmeda_human Transmembrane emp24 domain-containing protein 10 21 kDa transmembrane-trafficking protein Transmembrane protein Tmp21 Tmp-21-I p24delta S31III125 TMED10 TMP21 p23 p24 family protein delta-1 S31I125 protein protein human Homo sapiens Human MSGLSGPPARRGPFPLALLLLFLLGPRLVLAISFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGLRSHLKITDSAGHILYSKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPDQLVILDMKHGVEAKNYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMFCLIGLATWQVFYLRRFFKAKKLIE ptpn2-ptpn2 1186508 n/a 1186509 unspecified role unspecified role bait bait n/a 1186510 unspecified role unspecified role prey prey physical association physical association false false true 1B The interaction does not occur under these experimental conditions ptpn2-ptpn2-1 1186508 n/a 1186511 unspecified role unspecified role prey prey n/a 1186509 unspecified role unspecified role bait bait physical association physical association false false true 1B The interaction does not occur under these experimental conditions.