UniProt UniProt http://www.uniprot.org bellosta-2005-1 Myc interacts genetically with Tip48/Reptin and Tip49/Pontin to control growth and proliferation during Drosophila development. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Bellosta P., Hulf T., Balla Diop S., Usseglio F., Pradel J., Aragnol D., Gallant P. gallant@zool.unizh.ch C.elegans two-hybrid library Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 mimix curation bellosta-2005-2 Myc interacts genetically with Tip48/Reptin and Tip49/Pontin to control growth and proliferation during Drosophila development. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Bellosta P., Hulf T., Balla Diop S., Usseglio F., Pradel J., Aragnol D., Gallant P. gallant@zool.unizh.ch C.elegans two-hybrid library Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 mimix curation bellosta-2005-3 Myc interacts genetically with Tip48/Reptin and Tip49/Pontin to control growth and proliferation during Drosophila development. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Bellosta P., Hulf T., Balla Diop S., Usseglio F., Pradel J., Aragnol D., Gallant P. gallant@zool.unizh.ch C.elegans two-hybrid library Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 mimix curation bellosta-2005-4 Myc interacts genetically with Tip48/Reptin and Tip49/Pontin to control growth and proliferation during Drosophila development. drome-larva Drosophila melanogaster larva larva Immature form of an organism anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Bellosta P., Hulf T., Balla Diop S., Usseglio F., Pradel J., Aragnol D., Gallant P. gallant@zool.unizh.ch C.elegans two-hybrid library Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 mimix curation ruvb2_drome RuvB-like helicase 2 rept CG9750 Dreptin Reptin protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAETEKIEVRDVTRIERIGAHSHIRGLGLDDVLEARLVSQGMVGQKDARRAAGVVVQMVREGKIAGRCILLAGEPSTGKTAIAVGMAQALGTETPFTSMSGSEIYSLEMSKTEALSQALRKSIGVRIKEETEIIEGEVVEIQIERPASGTGQKVGKVTLKTTEMETNYDLGNKIIECFMKEKIQAGDVITIDKASGKVNKLGRSFTRARDYDATGAQTRFVQCPEGELQKRKEVVHTVTLHEIDVINSRTHGFLALFSGDTGEIKQEVRDQINNKVLEWREEGKAEINPGVLFIDEVHMLDIECFSFLNRALESDMAPVVVMATNRGITRIRGTNYRSPHGIPIDLLDRMIIIRTVPYSEKEVKEILKIRCEEEDCIMHPDALTILTRIATDTSLRYAIQLITTANLVCRRRKATEVNTEDVKKVYSLFLDENRSSKILKEYQDDYMFSEITEEVERDPAAGGGAKRRVEGGGGDAQPMEH myc_drome Myc protein Myc Diminutive protein dMyc1 dm CG10798 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MALYRSDPYSIMDDQLFSNISIFDMDNDLYDMDKLLSSSTIQSDLEKIEDMESVFQDYDLEEDMKPEIRNIDCMWPAMSSCLTSGNGNGIESGNSAASSYSETGAVSLAMVSGSTNLYSAYQRSQTTDNTQSNQQHVVNSAENMPVIIKKELADLDYTVCQKRLRLSGGDKKSQIQDEVHLIPPGGSLLRKRNNQDIIRKSGELSGSDSIKYQRPDTPHSLTDEVAASEFRHNVDLRACVMGSNNISLTGNDSDVNYIKQISRELQNTGKDPLPVRYIPPINDVLDVLNQHSNSTGGQQQLNQQQLDEQQQAIDIATGRNTVDSPPTTGSDSDSDDGEPLNFDLRHHRTSKSGSNASITTNNNNSNNKNNKLKNNSNGMLHMMHITDHSYTRCNDMVDDGPNLETPSDSDEEIDVVSYTDKKLPTNPSCHLMGALQFQMAHKISIDHMKQKPRYNNFNLPYTPASSSPVKSVANSRYPSPSSTPYQNCSSASPSYSPLSVDSSNVSSSSSSSSSQSSFTTSSSNKGRKRSSLKDPGLLISSSSVYLPGVNNKVTHSSMMSKKSRGKKVVGTSSGNTSPISSGQDVDAMDRNWQRRSGGIATSTSSNSSVHRKDFVLGFDEADTIEKRNQHNDMERQRRIGLKNLFEALKKQIPTIRDKERAPKVNILREAAKLCIQLTQEEKELSMQRQLLSLQLKQRQDTLASYQMELNESRSVSG ruvb1_drome RuvB-like helicase 1 pont CG4003 Pontin Dpontin protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MKIEEVKSTVRTQRIAAHSHVKGLGLDEVGAAVHSAAGLVGQKAAREAAGIVVDLIKSKKMAGRALLLAGPPGTGKTAIALAIAQELGNKVPFCPMVGSEVFSNEIKKTEVLMENFRRSIGLRIRETKEVYEGEVTELTPVETENPMGGYGKTISNVVIGLKTAKGTKQLKLDPSIFDALQKEKVEVGDVIYIEANSGAVKRQGRSDTFATEFDLETEEYVPLPKGDVHKKKEVIQDVTLHDLDVANARPQGGQDVLSMMGQLMKPKKTEITDKLRMEINKVVNKYIDQGIAELVPGVLFIDEIHMLDLETFTYLHKSLESPIAPIVIFATNRGRCVIRGTTDIVSPHGIPLDLLDRLLIIRTLLYSTADMEQIIKLRAQTEGLQLEENAFTRLSEIGTSSTLRYAVQLLTPAHQMCKVNGRNQISKDDIEDVHSLFLDAKRSSKHLSEKNNKFML rept-dm 1143417 n/a 1143421 unspecified role unspecified role bait bait n/a 1143422 unspecified role unspecified role prey prey physical association physical association false false false 1a dm-pont 1143417 n/a 1143422 unspecified role unspecified role bait bait n/a 1143423 unspecified role unspecified role prey prey physical association physical association false false false 1b rept-pont 1143417 n/a 1143423 unspecified role unspecified role prey prey n/a 1143421 unspecified role unspecified role bait bait physical association physical association false false false 1a rept-dm-1 1143417 n/a 1143421 unspecified role unspecified role bait bait n/a 1143423 unspecified role unspecified role prey prey n/a 1143422 unspecified role unspecified role prey prey association association false false false dm-pont-1 1143418 n/a 1143422 unspecified role unspecified role bait bait n/a 1143423 unspecified role unspecified role prey prey physical association physical association false false false 1d and e dm-rept 1143418 n/a 1143422 unspecified role unspecified role bait bait n/a 1143421 unspecified role unspecified role prey prey physical association physical association false false false 1d and e dm-pont-2 1143419 n/a 1143423 unspecified role unspecified role prey prey drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 1143422 unspecified role unspecified role bait bait physical association physical association false false false 4 supplement. dm-rept-1 1143419 n/a 1143422 unspecified role unspecified role bait bait n/a 1143421 unspecified role unspecified role prey prey physical association physical association false false false 4 supplement. dm-pont-3 1143420 n/a 1143423 unspecified role unspecified role prey prey n/a 1143422 unspecified role unspecified role bait bait physical association physical association false false false 1e