IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ simpson-2004-1 A classic zinc finger from friend of GATA mediates an interaction with the coiled-coil of transforming acidic coiled-coil 3. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Simpson R.J., Yi Lee S.H., Bartle N., Sum E.Y., Visvader J.E., Matthews J.M., Mackay J.P., Crossley M. j.mackay@mmb.usyd.edu.au Murine erythroleukemia cell cDNA J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation simpson-2004-4 A classic zinc finger from friend of GATA mediates an interaction with the coiled-coil of transforming acidic coiled-coil 3. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Simpson R.J., Yi Lee S.H., Bartle N., Sum E.Y., Visvader J.E., Matthews J.M., Mackay J.P., Crossley M. j.mackay@mmb.usyd.edu.au J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation simpson-2004-2 A classic zinc finger from friend of GATA mediates an interaction with the coiled-coil of transforming acidic coiled-coil 3. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Simpson R.J., Yi Lee S.H., Bartle N., Sum E.Y., Visvader J.E., Matthews J.M., Mackay J.P., Crossley M. j.mackay@mmb.usyd.edu.au J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation simpson-2004-3 A classic zinc finger from friend of GATA mediates an interaction with the coiled-coil of transforming acidic coiled-coil 3. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Simpson R.J., Yi Lee S.H., Bartle N., Sum E.Y., Visvader J.E., Matthews J.M., Mackay J.P., Crossley M. j.mackay@mmb.usyd.edu.au J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation simpson-2004-5 A classic zinc finger from friend of GATA mediates an interaction with the coiled-coil of transforming acidic coiled-coil 3. in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Simpson R.J., Yi Lee S.H., Bartle N., Sum E.Y., Visvader J.E., Matthews J.M., Mackay J.P., Crossley M. j.mackay@mmb.usyd.edu.au J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation simpson-2004-6 A classic zinc finger from friend of GATA mediates an interaction with the coiled-coil of transforming acidic coiled-coil 3. in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Simpson R.J., Yi Lee S.H., Bartle N., Sum E.Y., Visvader J.E., Matthews J.M., Mackay J.P., Crossley M. j.mackay@mmb.usyd.edu.au J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation simpson-2004-7 A classic zinc finger from friend of GATA mediates an interaction with the coiled-coil of transforming acidic coiled-coil 3. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Simpson R.J., Yi Lee S.H., Bartle N., Sum E.Y., Visvader J.E., Matthews J.M., Mackay J.P., Crossley M. j.mackay@mmb.usyd.edu.au J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation tacc3_mouse Transforming acidic coiled-coil-containing protein 3 Tacc3 Aint ARNT-interacting protein protein protein mouse Mus musculus Mouse MSLHVLNDENVPNEKSSQCRDFQFLPPELTGRSSVLCLSQKENVPPQSQAKATNVTFQTPPRDPQTHRILSPNMTNKREAPFGLQNDHCVFLQKENQRPLAPVDDAPVVQMAAEILRAEGELQEGILTSSSLSASTSLLDSELVTPPIEPVLEPSHQGLEPVLESELVTPPVEPVLEPSHQELEPVLESELVTPPIEPVLEPSHQGLEPVLDSELVTPPIEPVLEPSHQGLEPVLESELVTPPIEPVLEPSHQGLEPVLDSELVTPPIEPVLEPSHQGLEPVLDSELVTPPIEPLLEPSHQGLEPVVDLKEESFRDPSEVLGTGAEVDYLEQFGTSSFKESAWRKQSLYVKFDPLLKDSPLRPMPVAPITNSTQDTEEESGSGKPTEAELVNLDFLGDLDVPVSAPTPVWSLEPRGLLPAEPIVDVLKYSQKDLDAVVNVMQQENLELKSKYEDLNTKYLEMGKSVDEFEKIAYKSLEEAEKQRELKEIAEDKIQKVLKERDQLNADLNSMEKSFSDLFKRFEKRKEVIEGYQKNEESLKKYVGECIVKIEKEGQRYQALKIHAEEKLRLANEEIAQVHSKAQAEVLALQASLRKAQMQNHSLEMTLEQKTKEIDELTRICDDLISKMEKI fog1_mouse Zinc finger protein ZFPM1 Zfpm1 Fog Fog1 Friend of GATA protein 1 Zinc finger protein multitype 1 protein protein mouse Mus musculus Mouse MSRRKQSNPRQIKRSLRDMEAGEEAKAMDSSPKEQEAPDPEAPAIEEPPSPPREDVSPPAVPAPPESPEDPEDMEGQELEMRPQDEEKEEKEEEAAMASPWSGPEELELALQDGQRCVRARLSLTEGLSWGPFYGSIQTRALSPEREEPGPAVTLMVDESCWLRMLPQVLTEEAANSEIYRKDDALWCRVTKVVPSGGLLYVRLVTEPHGAPRHPVQEPVEPGGLAPVHTDIQLLPQQAGMASILATAVINKDVFPCKDCGIWYRSERNLQAHLLYYCASRQRAGSPVSATEEKPKETYPNERVCPFPQCRKSCPSASSLEIHMRSHSGERPFVCLICLSAFTTKANCERHLKVHTDTLSGVCHNCGFISTTRDILYSHLVTNHMVCQPGSKGEIYSPGAGHPAAKLPPDSLAGFQQHSLMHSPLVPADKAPTPSSGLDSKAEVTNGETRVPPQNGGSSESPAAPRTIKVEAAEEPEATRASGPGEPGPQAPSRTPSPHSPNPVRVKTELSSPTPGSSPGPGELTMAGTLFLPQYVFSPDAGTTTVPTAPQASEILAKMSELVHNRLQQGAGSSGAAGTPTGLFSGTKGATCFECEITFNNINNFYVHKRLYCSGRRAPEDPPTVRRPKAATGPARAPAGAAAEPDPSRSSPGPGPREEEASGTTTPEAEAAGRGSEGSQSPGSSVDDAEDDPSRTLCEACNIRFSRHETYTVHKRYYCASRHDPPPRRPPAPTTAPGPAAPALTAPPVRTRRRRKLYELPAAGAPPPAAGPAPVPVVPSPTAELPSSPRPGSASAGPAPALSPSPVPDGPIDLSKRPRRQSPDAPTALPALADYHECTACRVSFHSLEAYLAHKKYSCPAAPLRTTALCPYCPPNGRVRGDLVEHLRQAHGLQVAKPAASPGAEPRTPAERAPRDSPDGRAPRSPSPAPENTPSDPADQGARTPSKGPPAPAPAPGGGGGHRYCRLCNIRFSSLSTFIAHKKYYCSSHAAEHVK gata1_mouse Erythroid transcription factor Gata1 Gf-1 Eryf1 GATA-binding factor 1 NF-E1 DNA-binding protein protein protein mouse Mus musculus Mouse MDFPGLGALGTSEPLPQFVDSALVSSPSDSTGFFSSGPEGLDAASSSTSPNAATAAASALAYYREAEAYRHSPVFQVYPLLNSMEGIPGGSPYASWAYGKTALYPASTVCPSHEDAPSQALEDQEGKSNNTFLDTLKTERLSPDLLTLGTALPASLPVTGSAYGGADFPSPFFSPTGSPLSSAAYSSPKFHGSLPLAPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLIRPKKRMIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYFKLHQVNRPLTMRKDGIQTRNRKASGKGKKKRGSNLAGAGAAEGPAGGFMVVAGSSSSGNCGEVASGLALGTAGTAHLYQGLGPVVLSGPVSHLMPFPGPLLGSPTTSFPTGPAPTTSSTSVIAPLSS zfpm1-tacc3 1180059 n/a 1180066 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1180067 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1180073 1180071 physical association physical association false false false zfpm1-gata1 1180059 n/a 1180068 unspecified role unspecified role prey prey n/a 1180067 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false zfpm1-tacc3-2 1180060 n/a 1180066 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1180067 unspecified role unspecified role bait bait O35615:p.Thr343Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O35615:p.Thr344Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O35615:p.Asn347Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O35615:p.Arg350Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O35615:p.Val354Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1180087 1180080 physical association physical association false false false Fig. 1A,1D. zfpm1-tacc3-3 1180060 n/a 1180066 unspecified role unspecified role prey prey Q9JJ11:p.Arg619_Ile620delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9JJ11:p.Ile625_Ser626delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9JJ11:p.Glu629_Lys630delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9JJ11:p.Asp615_Glu616delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q9JJ11:p.Asp622_Asp623delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false n/a 1180067 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1180097 1180093 physical association physical association false false false Fig. 3 zfpm1-tacc3-1 1180061 n/a 1180067 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1180066 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro 1180104 1180101 physical association physical association false false false Fig. 1B tacc3-zfpm1 1180062 n/a 1180066 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1180067 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1C tacc3-zfpm1-1 1180063 n/a 1180066 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1180067 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false O35615:p.[Glu330Lys;Leu336Arg;Glu349Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) 1180115 1180111 direct interaction direct interaction false false false Fig. 2C tacc3-tacc3 1180064 n/a 1180066 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Fig. 4B tacc3-zfpm1-2 1180065 n/a 1180067 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1180066 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 1180128 1180125 direct interaction direct interaction false false false Fig. 2D Ka=1.4 x 10E4 m-1