IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ rodrigo_brenni-2004-1 Sgt1p and Skp1p modulate the assembly and turnover of CBF3 complexes required for proper kinetochore function. trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. pull down pull down western blot western blot Immuno blot Immuno blot Rodrigo-Brenni MC., Thomas S., Bouck DC., Kaplan KB. kbkaplan@ucdavis.edu Mol. Biol. Cell (1059-1524) 2004 Only protein-protein interactions imex curation rodrigo_brenni-2004-4 Sgt1p and Skp1p modulate the assembly and turnover of CBF3 complexes required for proper kinetochore function. trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rodrigo-Brenni MC., Thomas S., Bouck DC., Kaplan KB. kbkaplan@ucdavis.edu Mol. Biol. Cell (1059-1524) 2004 Only protein-protein interactions imex curation rodrigo_brenni-2004-2 Sgt1p and Skp1p modulate the assembly and turnover of CBF3 complexes required for proper kinetochore function. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rodrigo-Brenni MC., Thomas S., Bouck DC., Kaplan KB. kbkaplan@ucdavis.edu Mol. Biol. Cell (1059-1524) 2004 Only protein-protein interactions imex curation rodrigo_brenni-2004-3 Sgt1p and Skp1p modulate the assembly and turnover of CBF3 complexes required for proper kinetochore function. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Rodrigo-Brenni MC., Thomas S., Bouck DC., Kaplan KB. kbkaplan@ucdavis.edu Mol. Biol. Cell (1059-1524) 2004 Only protein-protein interactions imex curation cbf3c_yeast Centromere DNA-binding protein complex CBF3 subunit C CTF13 CBF3C YMR094W YM9582.19 YM6543.01 Chromosome transmission fidelity protein 13 Kinetochore protein CTF13 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPSFNPVRFLELPIDIRKEVYFHLDGNFCGAHPYPIDILYKSNDVELPGKPSYKRSKRSKKLLRYMYPVFATYLNIFEYSPQLIEKWLEYAFWLRYDCLVLDCFKVNHLYDGTLIDALEWTYLDNELRLAYFNKASMLEVWYTFKEYKKWVIDSVAFDELDLLNVSNIQFNIDNLTPQLVDKCLSILEQKDLFATIGEVQFGQDEEVGEEKDVDVSGANSDENSSPSSTIKNKKRSASKRSHSDNGNVGATHNQLTSISVIRTIRSMESMKSLRKITVRGEKLYELLINFHGFRDNPGKTISYIVKRRINEIRLSRMNQISRTGLADFTRWDNLQKLVLSRVAYIDLNSIVFPKNFKSLTMKRVSKIKWWNIEENILKELKVDKRTFKSLYIKEDDSKFTKFFNLRHTRIKELDKSEINQITYLRCQAIVWLSFRTLNHIKLQNVSEVFNNIIVPRALFDSKRVEIYRCEKISQVLVI 77B1C012FD74E56F skp1_yeast Suppressor of kinetochore protein 1 SKP1 CBF3D YDR328C D9798.14 Centromere DNA-binding protein complex CBF3 subunit D E3 ubiquitin ligase complex SCF subunit SKP1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVTSNVVLVSGEGERFTVDKKIAERSLLLKNYLNDMHDSNLQNNSDSESDSDSETNHKSKDNNNGDDDDEDDDEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDDDDSRKSAPVDSWDREFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEEEAAIRRENEWAEDR 746DDE6470A69432 sgt1_yeast Protein SGT1 SGT1 YOR057W YOR29-08 Suppressor of G2 allele of SKP1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPVEKDLKTAYKALYDEKEPLKALHLYDEILKGSPTNLTALIFKAACLEKLYFGFSDWHSDATMENAKELLDKALMTAEGRGDRSKIGLVNFRYFVHFFNIKDYELAQSYFKKAKNLGYVDDTLPLWEDRLETKLNKKNKKQKDSTNKHTIKPVESIENRGDNNSSHSPISPLKIETAPQESPKFKIDWYQSSTSVTISLFTVNLPESKEQVNIYISPNDRRTLSISYQVPKSGSEFQYNAKLSHEVDPKAVSLKIFPKKLEITLSKIDSTQWKKLEEDILTESSRLSDEGKNSDSATRLLSAETASKERLSYPSSSKKKIDWSKLDIDEEADEEAGSADSFFQKLYAGADPDTKRAMMKSFIESNGTALSTDWEDVSKGTVKTSPPEGMEPKHW 5DE65874BE155552 cbf3a_yeast Centromere DNA-binding protein complex CBF3 subunit A CEP2 CTF14 YGR140W CBF2 CBF3A NDC10 Chromosome transmission fidelity protein 14 Kinetochore protein CTF14 Centromere-binding factor 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MRSSILFLLKLMKIMDVQQQQEAMSSEDRFQELVDSLKPRTAHQYKTYYTKYIQWCQLNQIIPTPEDNSVNSVPYKDLPISAELIHWFLLDTLITDDKPGEKREETEDLDEEEENSFKIATLKKIIGSLNFLSKLCKVHENPNANIDTKYLESVTKLHTHWIDSQKAITTNETNNTNTQVLCPPLLKVSLNLWNPETNHLSEKFFKTCSEKLRFLVDFQLRSYLNLSFEERSKIRFGSLKLGKRDRDAIIYHKVTHSAEKKDTPGHHQLLALLPQDCPFICPQTTLAAYLYLRFYGIPSVSKGDGFPNLNADENGSLLQDIPILRGKSLTTYPREETFSNYYTTVFRYCHLPYKRREYFNKCNLVYPTWDEDTFRTFFNEENHGNWLEQPEAFAFPDKIPFDFKKIMNFKSPYTSYSTNAKKDPFPPPKDLLVQIFPEIDEYKRHDYEGLSQNSRDFLDLMEVLRERFLSNLPWIYKFFPNHDIFQDPIFGNSDFQSYFNDKTIHSKGSPILSFDILPGFNKIYKNKTNFYSLLIERPSQLTFASSHNPDTHPTQKQESEGPLQMSQLDTTQLNELLKQQSFEYVQFQTLSNFQILLSVFNKIFEKLEMKKSSRGYILHQLNLFKITLDERIKKSKIDDADKFIRDNQPIKKEENIVNEDGPNTSRRTKRPKQIRLLSIADSSDESSTEDSNVFKKDGESIEDGAYGENEDENDSEMQEQLKSMINELINSKISTFLRDQMDQFELKINALLDKILEEKVTRIIEQKLGSHTGKFSTLKRPQLYMTEEHNVGFDMEVPKKLRTSGKYAETVKDNDDHQAMSTTASPSPEQDQEAKSYTDEQEFMLDKSIDSIEGIILEWFTPNAKYANQCVHSMNKSGNKSWRANCEALYKERKSIVEFYIYLVNHESLDRYKAVDICEKLRDQNEGSFSRLAKFLRKWRHDHQNSFDGLLVYLSN cbf3b_yeast Centromere DNA-binding protein complex CBF3 subunit B CEP3 CBF3 YMR168C YM8520.17C CBF3B CSL1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFNRTTQLKSKHPCSVCTRRKVKCDRMIPCGNCRKRGQDSECMKSTKLITASSSKEYLPDLLLFWQNYEYWITNIGLYKTKQRDLTRTPANLDTDTEECMFWMNYLQKDQSFQLMNFAMENLGALYFGSIGDISELYLRVEQYWDRRADKNHSVDGKYWDALIWSVFTMCIYYMPVEKLAEIFSVYPLHEYLGSNKRLNWEDGMQLVMCQNFARCSLFQLKQCDFMAHPDIRLVQAYLILATTTFPYDEPLLANSLLTQCIHTFKNFHVDDFRPLLNDDPVESIAKVTLGRIFYRLCGCDYLQSGPRKPIALHTEVSSLLQHAAYLQDLPNVDVYREENSTEVLYWKIISLDRDLDQYLNKSSKPPLKTLDAIRRELDIFQYKVDSLEEDFRSNNSRFQKFIALFQISTVSWKLFKMYLIYYDTADSLLKVIHYSKVIISLIVNNFHAKSEFFNRHPMVMQTITRVVSFISFYQIFVESAAVKQLLVDLTELTANLPTIFGSKLDKLVYLTERLSKLKLLWDKVQLLDSGDSFYHPVFKILQNDIKIIELKNDEMFSLIKGLGSLVPLNKLRQESLLEEEDENNTEPSDFRTIVEEFQSEYNISDILS 2E24A0508080A09B ctf13-sgt1-1 1015935 n/a 1015939 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1015940 unspecified role unspecified role prey prey n/a 1015941 unspecified role unspecified role prey prey association association false false false Fig. 2A Mutating SKP1 to leu146ser, decreases Skp1 binding to the complex but increases the association between Ctf13 and Sgt1. ctf13-sgt1-2 1015935 n/a 1015939 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1015941 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2A ctf13-cbf2 1015935 n/a 1015942 unspecified role unspecified role prey prey n/a 1015943 unspecified role unspecified role prey prey n/a 1015939 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1015940 unspecified role unspecified role prey prey association association false false false Fig.3B Mutating SKP1 to leu146ser, decreases Cep3 binding to the complex ctf13-cbf2-1 1015935 n/a 1015939 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1015942 unspecified role unspecified role prey prey physical association physical association false false false Fig.3B sgt1-skp1-1 1015936 n/a 1015940 unspecified role unspecified role prey prey n/a 1015941 unspecified role unspecified role bait bait Q08446:p.Thr146Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 1C skp1-sgt1 1015936 n/a 1015940 unspecified role unspecified role bait bait P52286:p.Leu146Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1015941 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1D sgt1-skp1-4 1015937 n/a 1015941 unspecified role unspecified role bait bait n/a 1015940 unspecified role unspecified role prey prey n/a 1015939 unspecified role unspecified role ancillary ancillary region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig.5D sgt1-skp1-5 1015937 n/a 1015940 unspecified role unspecified role prey prey P52286:p.Ile172Asn mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P52286:p.Leu146Ser mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1015941 unspecified role unspecified role bait bait physical association physical association false false false Fig.5D ctf13-cep3 1015938 n/a 1015943 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1015939 unspecified role unspecified role bait bait physical association physical association false false false Fig. 5D