IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ rong-2003-3 PI3 kinase enhancer-Homer complex couples mGluRI to PI3 kinase, preventing neuronal apoptosis. rat-brain-hippocampus Hippocampus of rat brain rat-brain-hippocampus Hippocampus of rat brain anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rong R., Ahn J.Y., Huang H., Nagata E., Kalman D., Kapp J.A., Tu J., Worley P.F., Snyder S.H., Ye K. kye@emory.edu Nat. Neurosci. (1097-6256) 2003 Only protein-protein interactions imex curation rong-2003-2 PI3 kinase enhancer-Homer complex couples mGluRI to PI3 kinase, preventing neuronal apoptosis. rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rong R., Ahn J.Y., Huang H., Nagata E., Kalman D., Kapp J.A., Tu J., Worley P.F., Snyder S.H., Ye K. kye@emory.edu Nat. Neurosci. (1097-6256) 2003 Only protein-protein interactions imex curation rong-2003-1 PI3 kinase enhancer-Homer complex couples mGluRI to PI3 kinase, preventing neuronal apoptosis. rat-brain-hippocampus Hippocampus of rat brain rat-brain-hippocampus Hippocampus of rat brain confocal microscopy confocal microscopy immunostaining immunostaining Rong R., Ahn J.Y., Huang H., Nagata E., Kalman D., Kapp J.A., Tu J., Worley P.F., Snyder S.H., Ye K. kye@emory.edu Nat. Neurosci. (1097-6256) 2003 Only protein-protein interactions imex curation rong-2003-4 PI3 kinase enhancer-Homer complex couples mGluRI to PI3 kinase, preventing neuronal apoptosis. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Rong R., Ahn J.Y., Huang H., Nagata E., Kalman D., Kapp J.A., Tu J., Worley P.F., Snyder S.H., Ye K. kye@emory.edu Nat. Neurosci. (1097-6256) 2003 Only protein-protein interactions imex curation rong-2003-5 PI3 kinase enhancer-Homer complex couples mGluRI to PI3 kinase, preventing neuronal apoptosis. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Rong R., Ahn J.Y., Huang H., Nagata E., Kalman D., Kapp J.A., Tu J., Worley P.F., Snyder S.H., Ye K. kye@emory.edu Nat. Neurosci. (1097-6256) 2003 Only protein-protein interactions imex curation q9z214-1 Homer protein homolog 1 1c Vesl-1L Homer1 Homer Vesl PSD-Zip45 VASP/Ena-related gene up-regulated during seizure and LTP 1 protein protein rat Rattus norvegicus (Rat) Rat MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPAQNALPFSHSAGDRTQGLSHASSAISKHWEAELATLKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVTELECVSSQANAVHSHKTELSQTVQELEETLKVKEEEIERLKQEIDNARELQEQRDSLTQKLQEVEIRNKDLEGQLSELEQRLEKSQSEQDAFRSNLKTLLEILDGKIFELTELRDNLAKLLECS grm1_rat Metabotropic glutamate receptor 1 Grm1 Gprc1a Mglur1 protein protein rat Rattus norvegicus (Rat) Rat MVRLLLIFFPMIFLEMSILPRMPDRKVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSLISIRDEKDGLNRCLPDGQTLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGRKLLDFLIKSSFVGVSGEEVWFDEKGDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNIDDYKIQMNKSGMVRSVCSEPCLKGQIKVIRKGEVSCCWICTACKENEFVQDEFTCRACDLGWWPNAELTGCEPIPVRYLEWSDIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPVGYNGLLIMSCTYYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIAKPERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKPGAGNANSNGKSVSWSEPGGRQAPKGQHVWQRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDASTKTLYNVEEEDNTPSAHFSPPSSPSMVVHRRGPPVATTPPLPPHLTAEETPLFLADSVIPKGLPPPLPQQQPQQPPPQQPPQQPKSLMDQLQGVVTNFGSGIPDFHAVLAGPGTPGNSLRSLYPPPPPPQHLQMLPLHLSTFQEESISPPGEDIDDDSERFKLLQEFVYEREGNTEEDELEEEEDLPTASKLTPEDSPALTPPSPFRDSVASGSSVPSSPVSESVLCTPPNVTYASVILRDYKQSSSTL agap2_rat Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 Agap2 Centg1 Centaurin-gamma-1 Phosphatidylinositol 3-kinase enhancer protein protein rat Rattus norvegicus (Rat) Rat MSRGAGALQRRTTTYLISLTLVKLESVPPPPPSPSAAAVGAPGARGSEPRDPGSPRGAEEPGKKRHERLFHRQDALWISTSSAGAGGAEPPALSPAPASPARPVSPAPGRRLSLWAAPPGPPLSGGLSPDSKPGGAPSSSRRPLLSSPSWGGPEPEGRTGGGVPGSSSPHPGTGSRRLKVAPPPPAPKPFKTVTTSGAKAGGGKGAGSRLSWPESEGKPRVKGSKSTAGTGASAVAAGGGGSAAVTTSGGVGAGAGARGKLSPRKGKSKTLDNSDLHPGPSAGSPPLTVPAIPVPATSVTAASTQPLGPAPPITLEPPAPGLKRGREGGRASTRDRKMLKFISGIFTKSTGGPPGPGPLPGPQGLSSSSGSRELLGAELRASPKAVVNSQEWTLSRSIPELRLGVLGDVRSGKSSLIHRFLTGSYQVLEKPESEQYKKEMLVDGQTHLVLIREEAGAPDAKFSGWADAVIFVFSLEDESSFQAVSHLHGQLISLRGEGRGGLALALVGTQDRISASSPRVVGDARARALCTDMKRCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLLAACKSLPSSPSHSAASTPVAGQASNGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEKRSLDSRGETTGSGRAIPIKQSFLLKRSGNSLNKEWKKKYVTLSSNGFLLYHPSINDYIHSTHGKEMDLLRTTVKVPGKRPPRAISAFGPSASINGLVKDMSTVQMGEGPEASTPMPSPSPSPSSLQLPTDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLSTPSKTEGSAVQAEAKRKMWKLKSFGSLRNIYKAEENFEFLIVSSTGQTWHFEAASFEERDAWVQAIESQILASLQCCESSKVKLRTDSQSEAVAIQAIRNAKGNSTCVDCGAPNPTWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDWPRELTLVLTAIGNDTANRVWESDTRGRAKPTRDSSREERESWIRAKYEQLLFLAPLGTTEEPLGRQLWAAVEAQDVAAVLLLLAHARHGPLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQGRTALFYARQAGSQLCADILLQHGCPGEGGSTATTPSAATTPSITATPSPRRRSSAASLGRVDTTIALV home2_rat Homer protein homolog 2 Cupidin VASP/Ena-related gene up-regulated during seizure and LTP 2 Homer2 Vesl2 protein protein rat Rattus norvegicus (Rat) Rat MGEQPIFTTRAHVFQIDPSTKKNWVPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINSTITPNMTFTKTSQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVREAARLARDKSQEKIETSSNHSQESGCETPSSTQASSVNGTDDEKASHASPADTHLKSENDKLKIALTQSAANVKKWEIELQTLRESNARLTTALQESAASVEQWKRQFSICRDENDRLRSKIEELEEQCGEINREKEKNTQLKRRIEELESEVREKEMELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKGELKSFLEVLDGKIDDLHDFRRGLSKLGTDN home1_rat Homer protein homolog 1 Homer1 Homer Vesl PSD-Zip45 VASP/Ena-related gene up-regulated during seizure and LTP 1 protein protein rat Rattus norvegicus (Rat) Rat MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPAQNALPFSHSAGDRTQGLSHASSAISKHWEAELATLKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVTELECVSSQANAVHSHKTELSQTVQELEETLKVKEEEIERLKQEIDNARELQEQRDSLTQKLQEVEIRNKDLEGQLSELEQRLEKSQSEQDAFRSNLKTLLEILDGKIFELTELRDNLAKLLECS homer1-grm1 1186596 n/a 1186601 unspecified role unspecified role bait bait n/a 1186602 unspecified role unspecified role prey prey physical association physical association false false false 7a, 7d The antibody used to co-inmunoprecipitate Homer 1c and grm1 could not distingiush between Homer 1c and Homer 2a. The interaction is annotated to Homer 1c because its presence in the complex was confirmed by a specific antibody in western blot. Quisqualate (grm1 agonist) increased the interaction. mPEP (grm1 specific antagonist) disrupted the interaction. grm1-agap2 1186596 n/a 1186602 unspecified role unspecified role bait bait n/a 1186603 unspecified role unspecified role prey prey physical association physical association false false false 7b Quisqualate (grm1 agonist) increased the interaction. mPEP (grm1 specific antagonist) disrupted the interaction. homer1-agap2 1186596 n/a 1186603 unspecified role unspecified role prey prey n/a 1186601 unspecified role unspecified role bait bait physical association physical association false false false 7c The antibody used to co-inmunoprecipitate Homer 1c and agap2 could not distingiush between Homer 1c and Homer 2a. The interaction is annotated to Homer 1c because its presence in the complex was confirmed by a specific antibody in western blot. Quisqualate (grm1 agonist) increased the interaction. mPEP (grm1 specific antagonist) disrupted the interaction. homer1-agap2-8 1186596 n/a 1186601 unspecified role unspecified role bait bait n/a 1186603 unspecified role unspecified role prey prey n/a 1186603 competitor competitor competitor unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false 7d Quisqualate (grm1 agonist) increased the interaction. mPEP (grm1 specific antagonist) disrupted the interaction. agap2-homer1 1186597 n/a 1186603 unspecified role unspecified role prey prey n/a 1186601 unspecified role unspecified role bait bait physical association physical association false false false 3d homer2-agap2 1186597 n/a 1186603 unspecified role unspecified role prey prey n/a 1186604 unspecified role unspecified role bait bait physical association physical association false false false 3d agap2-grm1 1186598 n/a 1186603 unspecified role unspecified role neutral component neutral component n/a 1186602 unspecified role unspecified role neutral component neutral component association association false false false 2c homer1-agap2-4 1186599 n/a 1186603 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q8CGU4:p.Pro187Leu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1186601 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3c, 4d homer1-agap2-7 1186600 n/a 1186605 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false evh1 domain sufficient to bind sufficient binding region sufficient to bind range range range range false ecoli Escherichia coli (strain K12) n/a 1186603 unspecified role unspecified role prey prey cell lysate cell lysate binding region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 1186641 1186639 physical association physical association false false false 4c