UniProt UniProt http://www.uniprot.org wei-2003-1 Interaction with general transcription factor IIF (TFIIF) is required for the suppression of activated transcription by RPB5-mediating protein (RMP). in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Wei W., Gu J.X., Zhu C.Q., Sun F.Y., Dorjsuren D., Lin Y., Murakami S. Source of RAP74 and RAP30 taken from previous work of contributing scientist. semuraka@kenroku.ipc.kanazawa-u.ac.jp Cell Res. (1001-0602) 2003 mimix curation wei-2003-2 Interaction with general transcription factor IIF (TFIIF) is required for the suppression of activated transcription by RPB5-mediating protein (RMP). in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting autoradiography autoradiography Wei W., Gu J.X., Zhu C.Q., Sun F.Y., Dorjsuren D., Lin Y., Murakami S. Source of RAP74 and RAP30 taken from previous work of contributing scientist. semuraka@kenroku.ipc.kanazawa-u.ac.jp Cell Res. (1001-0602) 2003 mimix curation wei-2003-3 Interaction with general transcription factor IIF (TFIIF) is required for the suppression of activated transcription by RPB5-mediating protein (RMP). chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wei W., Gu J.X., Zhu C.Q., Sun F.Y., Dorjsuren D., Lin Y., Murakami S. Source of RAP74 and RAP30 taken from previous work of contributing scientist. semuraka@kenroku.ipc.kanazawa-u.ac.jp Cell Res. (1001-0602) 2003 mimix curation t2fa_human General transcription factor IIF subunit 1 Transcription initiation factor IIF subunit alpha GTF2F1 RAP74 Transcription initiation factor RAP74 General transcription factor IIF 74 kDa subunit protein protein human Homo sapiens Human MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLEMSSDASDASGEEGGRVPKAKKKAPLAKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSQEEPESKAKAPQQEEGPKGVDEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSEASSALFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSSTLRAAASKLEQGKRVSEMPAAKRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE rmp_human Unconventional prefoldin RPB5 interactor 1 URI1 C19orf2 NNX3 PPP1R19 Protein NNX3 Protein phosphatase 1 regulatory subunit 19 RMP RNA polymerase II subunit 5-mediating protein URI protein protein human Homo sapiens Human MEAPTVETPPDPSPPSAPAPALVPLRAPDVARLREEQEKVVTNCQERIQHWKKVDNDYNALRERLSTLPDKLSYNIMVPFGPFAFMPGKLVHTNEVTVLLGDNWFAKCSAKQAVGLVEHRKEHVRKTIDDLKKVMKNFESRVEFTEDLQKMSDAAGDIVDIREEIKCDFEFKAKHRIAHKPHSKPKTSDIFEADIANDVKSKDLLADKELWARLEELERQEELLGELDSKPDTVIANGEDTTSSEEEKEDRNTNVNAMHQVTDSHTPCHKDVASSEPFSGQVNSQLNCSVNGSSSYHSDDDDDDDDDDDDDNIDDDDGDNDHEALGVGDNSIPTIYFSHTVEPKRVRINTGKNTTLKFSEKKEEAKRKRKNSTGSGHSAQELPTIRTPADIYRAFVDVVNGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCSDTSESILEEEPQENQKKLLPLSVTPEAFSGTVIEKEFVSPSLTPPPAIAHPALPTIPERKEVLLEASEETGKRVSKFKAARLQQKD t2fb_human General transcription factor IIF subunit 2 GTF2F2 RAP30 Transcription initiation factor IIF subunit beta ATP-dependent helicase GTF2F2 Transcription initiation factor RAP30 General transcription factor IIF 30 kDa subunit protein protein human Homo sapiens Human MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAASENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQGEEKSD rpab1_human DNA-directed RNA polymerases I, II, and III subunit RPABC1 POLR2E DNA-directed RNA polymerase II subunit E RPB5 homolog DNA-directed RNA polymerase II 23 kDa polypeptide XAP4 protein protein human Homo sapiens Human MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ rmp-gtf2f1 1244906 n/a 1244909 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1244910 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) physical association physical association false false false 2A rmp-gtf2f2 1244906 n/a 1244911 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1244910 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) physical association physical association false false false 2B rmp-polr2e 1244906 n/a 1244910 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) n/a 1244912 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association false false false 2C gtf2f1-rmp 1244907 n/a 1244910 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1244909 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) physical association physical association false false false 3A gtf2f2-rmp-1 1244907 n/a 1244910 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1244911 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) physical association physical association false false false 3B rmp-gtf2f1-4 1244908 n/a 1244910 unspecified role unspecified role bait bait n/a 1244909 unspecified role unspecified role prey prey physical association physical association false false false 4B rmp-gtf2f2 1244908 n/a 1244910 unspecified role unspecified role bait bait n/a 1244911 unspecified role unspecified role prey prey physical association physical association false false false 4C