UniProt UniProt http://www.uniprot.org jenne-2002-1 Oligomeric state and stoichiometry of p24 proteins in the early secretory pathway. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Jenne N., Frey K., Brugger B., Wieland F.T. Felix.Wieland@urz-uni-heidelberg.de J. Biol. Chem. (0021-9258) 2002 Results of colocalization experimernts (confocal microscopy and immunostaining) carried out in Cercopithecus aethiops cells are not be captured as the respective proteins are not available in the databases (UniProt, Ensembl, NCBI). Colocalization has been demonstrated for TMED7 and TMED9, TMED7 and LMAN1, and TMED7, TMED2 and LMAN1, respectively. mimix curation jenne-2002-2 Oligomeric state and stoichiometry of p24 proteins in the early secretory pathway. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jenne N., Frey K., Brugger B., Wieland F.T. Felix.Wieland@urz-uni-heidelberg.de J. Biol. Chem. (0021-9258) 2002 Results of colocalization experimernts (confocal microscopy and immunostaining) carried out in Cercopithecus aethiops cells are not be captured as the respective proteins are not available in the databases (UniProt, Ensembl, NCBI). Colocalization has been demonstrated for TMED7 and TMED9, TMED7 and LMAN1, and TMED7, TMED2 and LMAN1, respectively. mimix curation tmeda_human Transmembrane emp24 domain-containing protein 10 21 kDa transmembrane-trafficking protein Transmembrane protein Tmp21 Tmp-21-I p24delta S31III125 TMED10 TMP21 p23 p24 family protein delta-1 S31I125 protein protein human Homo sapiens Human MSGLSGPPARRGPFPLALLLLFLLGPRLVLAISFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGLRSHLKITDSAGHILYSKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPDQLVILDMKHGVEAKNYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMFCLIGLATWQVFYLRRFFKAKKLIE tmed2_human Transmembrane emp24 domain-containing protein 2 TMED2 RNP24 Membrane protein p24A p24 family protein beta-1 p24 protein protein human Homo sapiens Human MVTLAELLVLLAALLATVSGYFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAMTLGQIYYLKRFFEVRRVV tmed9_human Transmembrane emp24 domain-containing protein 9 TMED9 GP25L2 Glycoprotein 25L2 p25 p24 family protein alpha-2 GMP25 protein protein human Homo sapiens Human MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRHLKSFFEAKKLV tmed7_human Transmembrane emp24 domain-containing protein 7 TMED7 CGI-109 p24 family protein gamma-3 p27 protein protein human Homo sapiens Human MPRPGSAQRWAAVAGRWGCRLLALLLLVPGPGGASEITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSENRVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSVGEALILLVVSIGQVFLLKSFFSDKRTTTTRVGS tmed1_human Transmembrane emp24 domain-containing protein 1 TMED1 IL1RL1L IL1RL1LG Interleukin-1 receptor-like 1 ligand Putative T1/ST2 receptor-binding protein p24 family protein gamma-1 protein protein human Homo sapiens Human MMAAGAALALALWLLMPPVEVGGAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDFTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFFELIFDSLQDDEEVEGWAEAVEPEEMLDVKMEDIKESIETMRTRLERSIQMLTLLRAFEARDRNLQEGNLERVNFWSAVNVAVLLLVAVLQVCTLKRFFQDKRPVPT tmed10-tmed10 1170804 n/a 1170806 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 physical association physical association false false false 3 tmed2-tmed2 1170804 n/a 1170807 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 physical association physical association false false false 2 tmed9-tmed9 1170804 n/a 1170808 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 physical association physical association false false false 2 tmed7-tmed7 1170804 n/a 1170809 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 physical association physical association false false false 2 tmed1-tmed1 1170804 n/a 1170810 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 physical association physical association false false false 2 tmed2-tmed10 1170805 n/a 1170806 unspecified role unspecified role prey prey n/a 1170807 unspecified role unspecified role bait bait n/a 1170808 unspecified role unspecified role prey prey association association false false false 5a tmed7-tmed10 1170805 n/a 1170809 unspecified role unspecified role bait bait n/a 1170806 unspecified role unspecified role prey prey n/a 1170807 unspecified role unspecified role prey prey association association false false false 5b