IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ finke-1996-1 A second trimeric complex containing homologs of the Sec61p complex functions in protein transport across the ER membrane of S. cerevisiae. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Finke K., Plath K., Panzner S., Prehn S., Rapoport TA., Hartmann E., Sommer T. EMBO J. (0261-4189) 1996 Only protein-protein interactions imex curation finke-1996-2 A second trimeric complex containing homologs of the Sec61p complex functions in protein transport across the ER membrane of S. cerevisiae. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Finke K., Plath K., Panzner S., Prehn S., Rapoport TA., Hartmann E., Sommer T. A digitonin extract was prepared from yeast microsomes, and subjected to chromatography on a Q-Sepharose column. The protein complexes were then bound to SP-Sepharose and eluted with a salt gradient. EMBO J. (0261-4189) 1996 Only protein-protein interactions imex curation finke-1996-3 A second trimeric complex containing homologs of the Sec61p complex functions in protein transport across the ER membrane of S. cerevisiae. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Finke K., Plath K., Panzner S., Prehn S., Rapoport TA., Hartmann E., Sommer T. Yeast cells were solubilized with digitonin, and the extract was centrifuged to obtain a supematant fraction (DE, for digitonin extract) and a ribosome pellet. Membrane proteins associated with the ribosomes were then released by treatment with puromycin and high salt concentrations (referred to as RAMP, for ribosome-associated membrane proteins). EMBO J. (0261-4189) 1996 Only protein-protein interactions imex curation sc61a_yeast Protein transport protein SEC61 Sec61 complex subunit SEC61 L3502.5 YLR378C SEC61 Sec61 complex subunit alpha protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSNRVLDLFKPFESFLPEVIAPERKVPYNQKLIWTGVSLLIFLILGQIPLYGIVSSETSDPLYWLRAMLASNRGTLLELGVSPIITSSMIFQFLQGTQLLQIRPESKQDRELFQIAQKVCAIILILGQALVVVMTGNYGAPSDLGLPICLLLIFQLMFASLIVMLLDELLSKGYGLGSGISLFTATNIAEQIFWRAFAPTTVNSGRGKEFEGAVIAFFHLLAVRKDKKRALVEAFYRTNLPNMFQVLMTVAIFLFVLYLQGFRYELPIRSTKVRGQIGIYPIKLFYTSNTPIMLQSALTSNIFLISQILFQKYPTNPLIRLIGVWGIRPGTQGPQMALSGLAYYIQPLMSLSEALLDPIKTIVYITFVLGSCAVFSKTWIEISGTSPRDIAKQFKDQGMVINGKRETSIYRELKKIIPTAAAFGGATIGALSVGSDLLGTLGSGASILMATTTIYGYYEAAAKEGGFTKNLVPGFSDLM sc61g_yeast Protein transport protein SSS1 Sec61 complex subunit SSS1 Ssh1 complex subunit SSS1 D4475 YDR086C SSS1 Sec61 complex subunit gamma Ssh1 complex subunit gamma protein protein yeast Saccharomyces cerevisiae Baker's yeast MARASEKGEEKKQSNNQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTKIVKAVGIGFIAVGIIGYAIKLIHIPIRYVIV sc6b1_yeast Protein transport protein SBH1 Sec61 complex subunit SBH1 YER087BC YER087C-B SBH1 SEB1 Sec61 complex subunit beta protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSPTPPGGQRTLQKRKQGSSQKVAASAPKKNTNSNNSILKIYSDEATGLRVDPLVVLFLAVGFIFSVVALHVISKVAGKLF sec72_yeast Translocation protein SEC72 SEC67 SIM2 L8003.18 YLR292C SEC72 Sec62/63 complex 23 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MVTLEYNANSKLITASDAVVALSTETNIDQINVLTTSLIGETNPNFTPQPNEALSKMIKGLFESGMKNLQQKKLNEALKNVSLAIEMAQRKRAPWEAFAIQLPELHFMLRSKIDLCLILGKHLEALQDLDFLLGTGLIQPDVFVRKADCLLKLRQWEEARATCERGLALAPEDMKLRALLIETARNLAEYNGE sec66_yeast Translocation protein SEC66 SEC71 YBR1232 YBR171W SEC66 HSS1 Sec62/63 complex 31.5 kDa subunit Protein HSS1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEFNETKFSNNGTFFETEEPIVETKSISVYTPLIYVFILVVSLVMFASSYRKKQAKKISEQPSIFDENDAHDLYFQIKEMSENEKIHEKVLKAALLNRGAESVRRSLKLKELAPQINLLYKNGSIGEDYWKRFETEVKLIELEFKDTLQEAERLQPGWVQLFVMVCKEICFNQALSRRYQSILKRKEVCIKEWELKINNDGRLVN E2A8BB4994A227D4 sc6b2_yeast Protein transport protein SBH2 SBH2 SEB2 Ssh1 complex subunit SBH2 Ssh1 complex subunit beta YER019BC YER019C-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MAASVPPGGQRILQKRRQAQSIKEKQAKQTPTSTRQAGYGGSSSSILKLYTDEANGFRVDSLVVLFLSVGFIFSVIALHLLTKFTHII sec62_yeast Translocation protein SEC62 SEC62 YPL094C LPG14C Sec62/63 complex 30 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAVGPGSNAGASVNGGSATAIATLLRNHKELKQRQGLFQAKQTDFFRYKRFVRALHSEEYANKSARQPEIYPTIPSNKIEDQLKSREIFIQLIKAQMVIPVKKLHSQECKEHGLKPSKDFPHLIVSNKAQLEADEYFVWNYNPRTYMDYLIVIGVVSIILALVCYPLWPRSMRRGSYYVSLGAFGILAGFFAVAILRLILYVLSLIVYKDVGGFWIFPNLFEDCGVLESFKPLYGFGEKDTYSYKKKLKRMKKKQAKRESNKKKAINEKAEQN ssh1_yeast Sec sixty-one protein homolog SSH1 Ssh1 complex subunit alpha Ssh1 complex subunit SSH1 YBR2020 YBR283C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGFRLIDIVKPILPILPEVELPFEKLPFDDKIVYTIFAGLIYLFAQFPLVGLPKATTPNVNDPIYFLRGVFGCEPRTLLEFGLFPNISSGLILQLLAGLKVIKVNFKIQSDRELFQSLTKVFAIVQYVILTNIFIFAGYFGDDLSVVQIGLINFQLVGAGIFTTLLAEVIDKGFGFSSGAMIINTVVIATNLVADTFGVSQIKVGEDDQTEAQGALINLIQGLRSKHKTFIGGIISAFNRDYLPNLTTTIIVLAIAIIVCYLQSVRVELPIRSTRARGTNNVYPIKLLYTGCLSVLFSYTILFYIHIFAFVLIQLVAKNEPTHIICKIMGHYENANNLLAVPTFPLSLLAPPTSFFKGVTQQPLTFITYSAFILVTGIWFADKWQAISGSSARDVALEFKDQGITLMGRREQNVAKELNKVIPIAAVTGASVLSLITVIGESLGLKGKAAGIVVGIAGGFSLLEVITIEYQQSGGQSALNQVLGVPGAM 48267EEA3E0191BD sec61-sbh1-1 Interaction between SEC61, SBH1 and SSS1 determined by coimmunoprecipitation 891213 n/a 891216 unspecified role unspecified role bait bait n/a 891217 unspecified role unspecified role prey prey n/a 891218 unspecified role unspecified role prey prey association association false false false Figs. 6A, 7B Interaction occurs in SBH2-/- cells sec61-sbh1-2 Interactors of SBH1 891213 n/a 891216 unspecified role unspecified role prey prey n/a 891218 unspecified role unspecified role bait bait n/a 891219 unspecified role unspecified role prey prey n/a 891217 unspecified role unspecified role prey prey n/a 891220 unspecified role unspecified role prey prey n/a 891221 unspecified role unspecified role prey prey n/a 891222 unspecified role unspecified role prey prey n/a 891223 unspecified role unspecified role prey prey association association false false false Fig. 6A sss1-sbh1-1 Interactors of SSS1 891213 n/a 891223 unspecified role unspecified role prey prey n/a 891219 unspecified role unspecified role prey prey n/a 891217 unspecified role unspecified role bait bait n/a 891222 unspecified role unspecified role prey prey n/a 891221 unspecified role unspecified role prey prey n/a 891220 unspecified role unspecified role prey prey n/a 891216 unspecified role unspecified role prey prey n/a 891218 unspecified role unspecified role prey prey association association false false false Fig. 6A ssh1-sss1-1 Interaction between SSH1, SSS1 and SEB2 determined by coimmunoprecipitation 891213 n/a 891217 unspecified role unspecified role bait bait n/a 891223 unspecified role unspecified role prey prey n/a 891221 unspecified role unspecified role prey prey association association false false false Fig. 6A ssh1-sss1-2 Interaction between SSH1, SSS1 and SEB2 determined by coimmunoprecipitation 891213 n/a 891221 unspecified role unspecified role bait bait n/a 891217 unspecified role unspecified role prey prey n/a 891223 unspecified role unspecified role prey prey association association false false false Figs. 6A, 7A Interaction observed in Sbh1-/- cells sec62-sss-1 Interactors of SEC62 891213 n/a 891219 unspecified role unspecified role prey prey n/a 891216 unspecified role unspecified role prey prey n/a 891220 unspecified role unspecified role prey prey n/a 891218 unspecified role unspecified role prey prey n/a 891217 unspecified role unspecified role prey prey n/a 891222 unspecified role unspecified role bait bait association association false false false Fig. 6A sec66-sss-1 Interactors of SEC66 (SEC71) 891213 n/a 891217 unspecified role unspecified role prey prey n/a 891216 unspecified role unspecified role prey prey n/a 891219 unspecified role unspecified role prey prey n/a 891218 unspecified role unspecified role prey prey n/a 891220 unspecified role unspecified role bait bait n/a 891222 unspecified role unspecified role prey prey association association false false false Fig. 6A sec61-sss1-2 Interaction between SEC61 and SSS1 determined by coimmunoprecipitation 891213 n/a 891216 unspecified role unspecified role bait bait n/a 891217 unspecified role unspecified role prey prey physical association physical association false false false Fig. 7A Interaction occurs in SBH1-/- cells sec61-sbh1-5 Interactors of SSS1 891213 n/a 891223 unspecified role unspecified role prey prey n/a 891216 unspecified role unspecified role prey prey n/a 891221 unspecified role unspecified role prey prey n/a 891217 unspecified role unspecified role bait bait n/a 891222 unspecified role unspecified role prey prey association association false false false Fig. 7A Interaction occurs in SBH1 -/- cells sec62-sss-2 Interactors of SEC62 891213 n/a 891222 unspecified role unspecified role bait bait n/a 891217 unspecified role unspecified role prey prey n/a 891216 unspecified role unspecified role prey prey association association false false false Fig. 6C, 7A, 7B Interaction occurs in SBH1-/- and SEB-/- cells. sec61-sbh1-6 Interaction between SEC61, SBH1 and SSS1 determined by coimmunoprecipitation 891213 n/a 891216 unspecified role unspecified role prey prey n/a 891217 unspecified role unspecified role prey prey n/a 891218 unspecified role unspecified role bait bait association association false false false Fig. 7B Interaction occurs in SEB2-/- cells sss1-sbh1-2 Interactors of SSS1 891213 n/a 891223 unspecified role unspecified role prey prey n/a 891216 unspecified role unspecified role prey prey n/a 891222 unspecified role unspecified role prey prey n/a 891218 unspecified role unspecified role prey prey n/a 891217 unspecified role unspecified role bait bait association association false false false Fig. 7B Interaction observed in SEB2-/- cells ssh1-sss1-5 Interaction between SSH1 and SSS1 determined by coimmunoprecipitation 891213 n/a 891223 unspecified role unspecified role bait bait n/a 891217 unspecified role unspecified role prey prey physical association physical association false false false Fig. 7B Interaction occurs in SEB2-/- cells sec61-sbh1-4 Interaction between SEC61, SBH1 and SSS1 determined by copurification 891214 n/a 891218 unspecified role unspecified role neutral component neutral component n/a 891216 unspecified role unspecified role neutral component neutral component n/a 891217 unspecified role unspecified role neutral component neutral component physical association physical association false false false Figs. 6C, 7E Interaction observed in SEB2-/- cells. ssh1-sss1-3 Interaction between SSH1, SSS1 and SEB2 determined by copurification 891214 n/a 891217 unspecified role unspecified role neutral component neutral component n/a 891221 unspecified role unspecified role neutral component neutral component n/a 891223 unspecified role unspecified role neutral component neutral component physical association physical association false false false Figs. 6C, 7D Interaction observed in Sbh1-/- cells. ssh1-sss1-4 Interaction between SSH1 and SSS1 determined by copurification 891214 n/a 891223 unspecified role unspecified role neutral component neutral component n/a 891217 unspecified role unspecified role neutral component neutral component physical association physical association false false false Fig. 6C, 7E Interaction occurs in SEB-/- cells sec61-sss1-3 Interaction between SEC61 and SSS1 determined by copurification 891214 n/a 891216 unspecified role unspecified role neutral component neutral component n/a 891217 unspecified role unspecified role neutral component neutral component physical association physical association false false false Figs. 6C, 7D Interaction observed in SBH1-/- cells sec61-sbh1-7 Interaction between SEC61, SBH1 and SSS1 determined by coimmunoprecipitation 891215 n/a 891217 unspecified role unspecified role prey prey n/a 891216 unspecified role unspecified role prey prey n/a 891218 unspecified role unspecified role bait bait association association false false false Fig. 8B ssh1-sss1-6 Interaction between SSH1, SSS1 and SEB2 determined by coimmunoprecipitation 891215 n/a 891221 unspecified role unspecified role prey prey n/a 891223 unspecified role unspecified role bait bait n/a 891217 unspecified role unspecified role prey prey association association false false false Fig. 8B