IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ cheng-2010b-6 A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. aedae-salivary_gland Aedes aegypti (Yellowfever mosquito) salivary gland Culex aegypti salivary_gland Salivary gland fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu Cell (0092-8674) 2010 Only protein-protein interactions imex curation cheng-2010b-1 A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu Cell (0092-8674) 2010 Only protein-protein interactions imex curation cheng-2010b-2 A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. aedae-hemocyte Aedes aegypti (Yellowfever mosquito) hemocyte Culex aegypti hemocyte Hemocyte fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu Cell (0092-8674) 2010 Only protein-protein interactions imex curation cheng-2010b-3 A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu Cell (0092-8674) 2010 Only protein-protein interactions imex curation cheng-2010b-4 A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. A stable cell line was generated to express mosPTP-1 in S2 cells. Purified mosGCTL-1 was inoculated with mosPTP-1-expressing cells. An empty DNA vector transfected stable S2 cell line was used as the control.mosPTP-1 was stained by Alexa-488; mosGCTL-1 was stained by Phycoerythrin. erol.fikrig@yale.edu Cell (0092-8674) 2010 Only protein-protein interactions imex curation cheng-2010b-5 A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. confocal microscopy confocal microscopy immunostaining immunostaining Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu Cell (0092-8674) 2010 Only protein-protein interactions imex curation cheng-2010b-7 A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu Cell (0092-8674) 2010 Only protein-protein interactions imex curation p06935-pro_0000037746 Envelope protein E protein protein wnv West Nile virus (WNV) FNCLGMSNRDFLEGVSGATWVDLVLEGDSCVTIMSKDKPTIDVKMMNMEAANLADVRSYCYLASVSDLSTRAACPTMGEAHNEKRADPAFVCKQGVVDRGWGNGCGLFGKGSIDTCAKFACTTKATGWIIQKENIKYEVAIFVHGPTTVESHGKIGATQAGRFSITPSAPSYTLKLGEYGEVTVDCEPRSGIDTSAYYVMSVGEKSFLVHREWFMDLNLPWSSAGSTTWRNRETLMEFEEPHATKQSVVALGSQEGALHQALAGAIPVEFSSNTVKLTSGHLKCRVKMEKLQLKGTTYGVCSKAFKFARTPADTGHGTVVLELQYTGTDGPCKVPISSVASLNDLTPVGRLVTVNPFVSVATANSKVLIELEPPFGDSYIVVGRGEQQINHHWHKSGSSIGKAFTTTLRGAQRLAALGDTAWDFGSVGGVFTSVGKAIHQVFGGAFRSLFGGMSWITQGLLGALLLWMGINARDRSIAMTFLAVGGVLLFLSVNVHA 291 787 q17nz6_aedae CTLMA15 5563672 AAEL000563 protein protein aedae Aedes aegypti (Yellowfever mosquito) Culex aegypti Yellowfever mosquito MLTKGITLILLLVLVHSSHGDSTPNRKFYIPSIRANWFKANEFCNSLKMRLVAIRSQEDNDAVARYVRTTSKFTDNCSFWIGASDLADEGTFVWVATGEEVTYTNWRENEPNNEGGNEDCIQLAYIPALNYHWSWNDNTCAGQSLYFICESVECDCVQPF q16k62_aedae Protein-tyrosine-phosphatase AAEL013105 protein protein aedae Aedes aegypti (Yellowfever mosquito) Culex aegypti Yellowfever mosquito MKTRLLTTLTWLALVQVLVVLVNHRGCALATVNLTESNGSTPYVVSEPEIPYEELEEPRVLPLQALPVSVKASSSESPNGADADIRNKHRFNQNIHGPDQPHADINTVLKVILEEPEINDEPFTTTHGYPTFSAYDNIVPSKPLNLSVLEVTSTTIKITWREPEKLNGAIHGYRVYYVHQNQTLLHLPILKADAAVNSVYTYTLSNLKPYTDYKIIVAAFTKKFDGEPSEVSQRTDISGPSAPKVVNLTCHSQHELLFGWHIPQTYYNTIDYYIISYRNLEHSEYKDIRLSANSSIVETSMIIPNLTTNMVYEVKVRAASASVINPKQIILGSYSEPKKISLQLHCEKIPQPSQRQVYDDYNLAVLGGIVFSCFGLLLIVLSFLLWKKCFHAAYYYLDDPPACQGANTAGLIDWEAPCEVAGEVRGPIPVTEFAKHVASLHVDGDIGFSKEYEAIQGEALNDEYPSEHSQHPDNKGKNRYLNVIAYDHSRVHLRQVPGQKKHLDYINANYIDGYQRPRSFIGTQGPLPGTFDCFWRMIWEQRVAIIVMITNLVERGRRKCDMYWPKDGAEMYGVIQVRLIREDVMATYTVRTLQIKHTKLKKKKASQSEKLVYQYHYTNWPDHGTPDHPLPVINFVKKSTAANPSDAGPIVVHCSAGVGRTGTYIVLDAMLKQIESKGMLNVFGFLRYIRAQRNYLVQTEEQYIFIHDALVEAIDSGETNIKMDAIGGLVNNIDFIDNQYKLITSYQPKEINLTSALKSVNAIKNRSSLVPLEGSRVHLTPKPGVEGSDYINASWLHGFRRLRDFVVTQHPLIETFKDFWQMVWDHNAQTVVLLSSADNMSFLQFWPNESEPMESDYYRIRMVSETSENNYIVRNFVIQSIQDDYELSVRMFENPMWPDMANPRSIYDFAVRVHERCAQYRNGPIVVVDRYHWKYF gctl1-e_wnv-3 978349 n/a 978356 unspecified role unspecified role neutral component neutral component n/a 978357 unspecified role unspecified role neutral component neutral component region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Supp. Fig. 3E gctl1-e_wnv-4 978349 n/a 978356 unspecified role unspecified role neutral component neutral component n/a 978357 unspecified role unspecified role neutral component neutral component region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 978358 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 5D gctl1-e_wnv-1 978350 n/a 978356 unspecified role unspecified role bait bait n/a 978357 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction false false false Interaction is calcium-dependent. Fig. 3B gctl1-e_wnv-2 978351 n/a 978357 unspecified role unspecified role neutral component neutral component region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 978356 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 3E gctl1-ptp1-1 978352 n/a 978358 unspecified role unspecified role prey prey n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 978357 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction false false false Fig. 3D gctl1-ptp1-2 978353 n/a 978358 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 978357 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. physical association physical association false false false Fig. 3E gctl1-ptp1-3 978354 n/a 978358 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 978357 unspecified role unspecified role neutral component neutral component region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. colocalization colocalization false false false Fig. 4F gctl1-e_wnv-5 978355 n/a 978357 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 978356 unspecified role unspecified role prey prey direct interaction direct interaction false false false mosGCTL-1 antisera blocked the interaction between mosGCTL-1 and WNV E protein. Fig. 6A