MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint ren-2010-2 VHS domains of ESCRT-0 cooperate in high-avidity binding to polyubiquitinated cargo. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Ren X., Hurley JH. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation ren-2010-1 VHS domains of ESCRT-0 cooperate in high-avidity binding to polyubiquitinated cargo. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ren X., Hurley JH. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation stam1_human Signal transducing adapter molecule 1 STAM STAM1 protein protein human Homo sapiens Human MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQGIGLFPSNFVTADLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEPAFIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQNQPYYMQSSGVSGSQVYAGPPPSGAYLVAGNAQMSHLQSYSLPPEQLSSLSQAVVPPSANPALPSQQTQAAYPNTMVSSVQGNTYPSQAPVYSPPPAATAAAATADVTLYQNAGPNMPQVPNYNLTSSTLPQPGGSQQPPQPQQPYSQKALL ubb_bovin Polyubiquitin-B UBB protein protein bovin Bos taurus (Bovine) Bovine MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC hse1_yeast Class E vacuolar protein-sorting machinery protein HSE1 YHL002W HSE1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSSAIKIRNALLKATDPKLRSDNWQYILDVCDLVKEDPEDNGQEVMSLIEKRLEQQDANVILRTLSLTVSLAENCGSRLRQEISSKNFTSLLYALIESHSVHITLKKAVTDVVKQLSDSFKDDPSLRAMGDLYDKIKRKAPYLVQPNVPEKHNMSTQADNSDDEELQKALKMSLFEYEKQKKLQEQEKESAEVLPQQQQQHQQQNQAPAHKIPAQTVVRRVRALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNYVTPIVEPSKEEIEKEKNKEAIVFSQKTTIDQLHNSLNAASKTGNSNEVLQDPHIGDMYGSVTPLRPQVTRMLGKYAKEKEDMLSLRQVLANAERSYNQLMDRAANAHISPPVPGPALYAGMTHANNTPVMPPQRQSYQSNEYSPYPSNLPIQHPTNSANNTPQYGYDLGYSVVSQPPPGYEQ 026267836BBADF69 hgs_human Hepatocyte growth factor-regulated tyrosine kinase substrate Protein pp110 Hrs HGS HRS protein protein human Homo sapiens Human MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSEAQLISFD vps27_yeast Vacuolar protein sorting-associated protein 27 VPS27 YNR006W N2038 DID7 SSV17 VPL23 VPT27 Golgi retention defective protein 11 GRD11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSVSTPSELDALIEQATSESIPNGDLDLPIALEISDVLRSRRVNPKDSMRCIKKRILNTADNPNTQLSSWKLTNICVKNGGTPFIKEICSREFMDTMEHVILREDSNEELSELVKTILYELYVAFKNDSQLNYVAKVYDKLISRGIKFPEKLTLSNSPTAMFDSKTPADWIDSDACMICSKKFSLLNRKHHCRSCGGVFCQEHSSNSIPLPDLGIYEPVRVCDSCFEDYDLKRHDDSKKSKKHRHKRKKDRDYSTPEDEEELIRKAIELSLKESRNSASSEPIVPVVESKNEVKRQEIEEEEDPDLKAAIQESLREAEEAKLRSERQKASRQMQPQQPSPQPQPIHSVDLSDEEKDSIYMFASLVEKMKSRPLNEILEDSKLQNLAQRVFASKARLNYALNDKAQKYNTLIEMNGKISEIMNIYDRLLEQQLQSINLSQQYTLPQVPSDPYNYLTENVQNPAESYQTPPLQQLSSHQYKPQQDVSRQQSVKANSSPTTNIDHLKTIDVTPHAQQKPQSHVELAPSDPPYPKEEAEDEGTQAVQDEESSTQESRERPYPVETENGETSINKRPQGITRYDFPTVPARKFVQPESTVPLPASSSEIPIKEERPPSPQEELLIEL 76C4501B0EBC9C84 gga3_human ADP-ribosylation factor-binding protein GGA3 Golgi-localized, gamma ear-containing, ARF-binding protein 3 GGA3 KIAA0154 protein protein human Homo sapiens Human MAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLIPSPPPRPKNPVFDDEEKSKLLAKLLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVRLLSEMLLHYSQEDSSDGDRELMKELFDQCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTIIEGQVINGEVATLTLPDSEGNSQCSNQGTLIDLAELDTTNSLSSVLAPAPTPPSSGIPILPPPPQASGPPRSRSSSQAEATLGPSSTSNALSWLDEELLCLGLADPAPNVPPKESAGNSQWHLLQREQSDLDFFSPRPGTAACGASDAPLLQPSAPSSSSSQAPLPPPFPAPVVPASVPAPSAGSSLFSTGVAPALAPKVEPAVPGHHGLALGNSALHHLDALDQLLEEAKVTSGLVKPTTSPLIPTTTPARPLLPFSTGPGSPLFQPLSFQSQGSPPKGPELSLASIHVPLESIKPSSALPVTAYDKNGFRILFHFAKECPPGRPDVLVVVVSMLNTAPLPVKSIVLQAAVPKSMKVKLQPPSGTELSPFSPIQPPAAITQVMLLANPLKEKVRLRYKLTFALGEQLSTEVGEVDQFPPVEQWGNL gga1_yeast ADP-ribosylation factor-binding protein GGA1 GGA1 YDR358W D9476.2 Golgi-localized, gamma ear-containing, ARF-binding protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPQRIELTSEPVRKPRSTESSLLRKIQRACRSTLPEPDLGLNLDVADYINSKQGATPREAVLAIEKLVNNGDTQAAVFALSLLDVLVKNCGYSIHLQISRKEFLNDLVKRFPEQPPLRYSKVQQMILEAIEEWYQTICKHASYKDDLQYINDMHKLLKYKGYTFPKVGSENLAVLRPNDQLRTPSELQEEQERAQAAKLEELLRSGKPDDLKEANKLMKIMAGFKDDTKVAVKQAINNELNKLKRKADLFNEMLTSADEPDLENEAIQELYGDLKSAQPKFKKLIEEERDDDALVSNLSKFNDLVIQLLKRYKSIKGMKEEELNVPDTNEPAKELNLIDFDDDTTANTPSVTSPSKSLQPFDDLLGDFNKVSLSSPKSPQENDTVVDILGDAHSKSSGIDLLDFDSQPGESKTALSAYSNSIVLPNGLLNSSSNSKEITAQSQRHILNQSDHLRIDYELTRESMTKLRLVIFYSNISSDPITNFALLVASPKGTTLSLQPQSGNMLQSNSRDGIKQIASVEGISVNLGKPIKLKWKANYCTKGDSKEESGTTSLPTI tom1_human Target of Myb protein 1 TOM1 protein protein human Homo sapiens Human MDFLLGNPFSSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDALRAVKKRIVGNKNFHEVMLALTVLETCVKNCGHRFHVLVASQDFVESVLVRTILPKNNPPTIVHDKVLNLIQSWADAFRSSPDLTGVVTIYEDLRRKGLEFPMTDLDMLSPIHTPQRTVFNSETQSGQDSVGTDSSQQEDSGQHAAPLPAPPILSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGAIPVTQACLMEDIEQWLSTDVGNDAEEPKGVTSEEFDKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDDMLFAL tm1l1_human TOM1-like protein 1 Target of Myb-like protein 1 Src-activating and signaling molecule protein TOM1L1 SRCASM protein protein human Homo sapiens Human MAFGKSHRDPYATSVGHLIEKATFAGVQTEDWGQFMHICDIINTTQDGPKDAVKALKKRISKNYNHKEIQLTLSLIDMCVQNCGPSFQSLIVKKEFVKENLVKLLNPRYNLPLDIQNRILNFIKTWSQGFPGGVDVSEVKEVYLDLVKKGVQFPPSEAEAETARQETAQISSNPPTSVPTAPALSSVIAPKNSTVTLVPEQIGKLHSELDMVKMNVRVMSAILMENTPGSENHEDIELLQKLYKTGREMQERIMDLLVVVENEDVTVELIQVNEDLNNAILGYERFTRNQQRILEQNKNQKEATNTTSEPSAPSQDLLDLSPSPRMPRATLGELNTMNNQLSGLNFSLPSSDVTNNLKPSLHPQMNLLALENTEIPPFAQRTSQNLTSSHAYDNFLEHSNSVFLQPVSLQTIAAAPSNQSLPPLPSNHPAMTKSDLQPPNYYEVMEFDPLAPAVTTEAIYEEIDAHQHKGAQNDGD ubc_human Polyubiquitin-C UBC protein protein human Homo sapiens Human MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGV stam-ubb 918524 stam1_human STAM1 918526 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q92783:p.Trp26Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false 918524 domino mint t2 f1d f3 stam-ubb-1 918524 stam1_human STAM1 918526 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q92783:p.Asp31Gln mutation decreasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false 918524 domino mint t2 f1d stam-ubb-2 918524 stam1_human STAM1 918526 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q92783:p.Leu30Asp mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false 918524 domino mint t2 f1d f3 stam-ubb-3 918524 ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified stam1_human STAM1 918526 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Q92783:p.Gly27Glu mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 918524 domino mint t2 f1d hse1-ubb 918524 hse1_yeast sc HSE1 918528 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false 918524 domino mint t2 f3 hse1-ubb-1 918524 hse1_yeast sc HSE1 918528 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified P38753:p.Ala170Gln mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P38753:p.Ser174Asp mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false 918524 t2 domino mint hgs-ubb 918524 hgs_human HRS 918529 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false 918524 domino mint t2 f3 vps27-ubb 918524 vps27_yeast Vps27 918530 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false 918524 domino mint t2 f3 vps27-ubb-1 918524 ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified vps27_yeast Vps27 918530 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P40343:p.Ser270Asp mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P40343:p.Ala266Gln mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 918524 t2 domino mint vps27-ubb-2 918524 ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified vps27_yeast Vps27 918530 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 918524 t2 domino mint stam-ubb-4 918524 stam1_human STAM1 918526 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false 918524 t2 domino mint gga3-ubb 918524 gga3_human GGA3 918531 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false 918524 domino mint t2 f3 gga1-ubb 918524 ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified gga1_yeast sc GGA1 918532 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 918524 domino mint t2 f3 tom1-ubb 918524 tom1_human TOM1 918533 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false 918524 domino mint t2 f3 tom1l1-ubb 918524 ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified tm1l1_human TOM1L1 918534 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 918524 domino mint t2 f3 stam-ubb-5 918524 ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified ubiquitinated lysine xlnk-n6lys-1gly N6-glycyl-L-lysine (2S)-2-amino-6-[(aminoacetyl)amino]hexanoic acid N6-(glycyl)-L-lysine N6-glycyllysine XLNK-N6Lys-1Gly CROSSLNK Glycyl lysine isopeptide (Gly-Lys) (interchain with K-...) CROSSLNK Glycyl lysine isopeptide (Lys-Gly) (interchain with G-...) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm stam1_human STAM1 918526 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 918524 mint t2 f4b sf2c vps27-ubb-3 918524 ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified vps27_yeast Vps27 918530 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 918524 mint t2 sf2f hgs-ubb-1 918524 ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified ubiquitinated lysine xlnk-n6lys-1gly N6-glycyl-L-lysine (2S)-2-amino-6-[(aminoacetyl)amino]hexanoic acid N6-(glycyl)-L-lysine N6-glycyllysine XLNK-N6Lys-1Gly CROSSLNK Glycyl lysine isopeptide (Gly-Lys) (interchain with K-...) CROSSLNK Glycyl lysine isopeptide (Lys-Gly) (interchain with G-...) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm hgs_human HRS 918529 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 918524 domino mint t2 f4c sf2d hgs-ubb-2 918524 hgs_human HRS 918529 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false 918524 mint t2 f4c stam-ubb-6 918524 stam1_human STAM1 918526 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false 918524 mint t2 f4b stam-ubb-7 918524 ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified ubiquitinated lysine xlnk-n6lys-1gly N6-glycyl-L-lysine (2S)-2-amino-6-[(aminoacetyl)amino]hexanoic acid N6-(glycyl)-L-lysine N6-glycyllysine XLNK-N6Lys-1Gly CROSSLNK Glycyl lysine isopeptide (Gly-Lys) (interchain with K-...) CROSSLNK Glycyl lysine isopeptide (Lys-Gly) (interchain with G-...) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm stam1_human STAM1 918526 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 918524 mint t2 f4b sf2c hgs-ubb-3 918524 hgs_human HRS 918529 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false 918524 domino mint t2 f4c sf2d hgs-ubb-4 918524 hgs_human HRS 918529 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified ubiquitinated lysine xlnk-n6lys-1gly N6-glycyl-L-lysine (2S)-2-amino-6-[(aminoacetyl)amino]hexanoic acid N6-(glycyl)-L-lysine N6-glycyllysine XLNK-N6Lys-1Gly CROSSLNK Glycyl lysine isopeptide (Gly-Lys) (interchain with K-...) CROSSLNK Glycyl lysine isopeptide (Lys-Gly) (interchain with G-...) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm direct interaction direct interaction false false false 918524 domino mint t2 f4c sf2d hgs-ubb-5 918524 hgs_human HRS 918529 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified ubiquitinated lysine xlnk-n6lys-1gly N6-glycyl-L-lysine (2S)-2-amino-6-[(aminoacetyl)amino]hexanoic acid N6-(glycyl)-L-lysine N6-glycyllysine XLNK-N6Lys-1Gly CROSSLNK Glycyl lysine isopeptide (Gly-Lys) (interchain with K-...) CROSSLNK Glycyl lysine isopeptide (Lys-Gly) (interchain with G-...) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm direct interaction direct interaction false false false 918524 mint t2 f4c fs2d hgs-ubb-6 918524 ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified ubiquitinated lysine xlnk-n6lys-1gly N6-glycyl-L-lysine (2S)-2-amino-6-[(aminoacetyl)amino]hexanoic acid N6-(glycyl)-L-lysine N6-glycyllysine XLNK-N6Lys-1Gly CROSSLNK Glycyl lysine isopeptide (Gly-Lys) (interchain with K-...) CROSSLNK Glycyl lysine isopeptide (Lys-Gly) (interchain with G-...) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm hgs_human HRS 918529 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 918524 mint t2 f4c sf2e vps27-ubb-4 918524 ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified ubiquitinated lysine xlnk-n6lys-1gly N6-glycyl-L-lysine (2S)-2-amino-6-[(aminoacetyl)amino]hexanoic acid N6-(glycyl)-L-lysine N6-glycyllysine XLNK-N6Lys-1Gly CROSSLNK Glycyl lysine isopeptide (Gly-Lys) (interchain with K-...) CROSSLNK Glycyl lysine isopeptide (Lys-Gly) (interchain with G-...) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm vps27_yeast Vps27 918530 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 918524 mint t2 sf2f vps27-ubb-5 918524 vps27_yeast Vps27 918530 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified ubiquitinated lysine xlnk-n6lys-1gly N6-glycyl-L-lysine (2S)-2-amino-6-[(aminoacetyl)amino]hexanoic acid N6-(glycyl)-L-lysine N6-glycyllysine XLNK-N6Lys-1Gly CROSSLNK Glycyl lysine isopeptide (Gly-Lys) (interchain with K-...) CROSSLNK Glycyl lysine isopeptide (Lys-Gly) (interchain with G-...) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm direct interaction direct interaction false false false 918524 mint t2 sf2f stam-ubb-8 918524 ubb_bovin Ubiquitin 918527 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified stam1_human STAM1 918526 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q92783:p.Leu30Asp mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 918524 domino mint t2 f1d stam-ubc 918525 ubc_human Ubiquitin 918535 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified stam1_human STAM1 918526 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false homomint domino mint t1 f1a f1b f1c