MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint suh-2010-2 Structural insights into the dual nucleotide exchange and GDI displacement activity of SidM/DrrA. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Suh HY., Lee DW., Lee KH., Ku B., Choi SJ., Woo JS., Kim YG., Oh BH. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation suh-2010-3 Structural insights into the dual nucleotide exchange and GDI displacement activity of SidM/DrrA. in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Suh HY., Lee DW., Lee KH., Ku B., Choi SJ., Woo JS., Kim YG., Oh BH. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation suh-2010-1 Structural insights into the dual nucleotide exchange and GDI displacement activity of SidM/DrrA. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Suh HY., Lee DW., Lee KH., Ku B., Choi SJ., Woo JS., Kim YG., Oh BH. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation suh-2010-4 Structural insights into the dual nucleotide exchange and GDI displacement activity of SidM/DrrA. in vitro In vitro competition binding competition binding predetermined predetermined participant predetermined Suh HY., Lee DW., Lee KH., Ku B., Choi SJ., Woo JS., Kim YG., Oh BH. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation suh-2010-5 Structural insights into the dual nucleotide exchange and GDI displacement activity of SidM/DrrA. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection pull down pull down predetermined predetermined participant predetermined Suh HY., Lee DW., Lee KH., Ku B., Choi SJ., Woo JS., Kim YG., Oh BH. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation drra_legph Multifunctional virulence effector protein DrrA lpg2464 drrA Defects in Rab1 recruitment protein A sidM protein protein legph Legionella pneumophila subsp. pneumophila MSIMGRIKMSVNEEQFGSLYSDERDKPLLSPTAQKKFEEYQNKLANLSKIIRENEGNEVSPWQEWENGLRQIYKEMIYDAFDALGVEMPKDMEVHFAGSLAKAQATEYSDLDAFVIVKNDEDIKKVKPVFDALNNLCQRIFTASNQIYPDPIGINPSRLIGTPDDLFGMLKDGMVADVEATAMSILTSKPVLPRYELGEELRDKIKQEPSFSNMVSAKKFYNKAIKDFTAPKEGAEVVSVKTHIMRPIDFMLMGLREEFNLYSEDGAHLSAPGTIRLLREKNLLPEEQIARIESVYNQAMSKRFELHAEHKKEHDEMPYSDAKAMLDEVAKIRELGVQRVTRIENLENAKKLWDNANSMLEKGNISGYLKAANELHKFMKEKNLKEDDLRPELSDKTISPKGYAILQSLWGAASDYSRAAATLTESTVEPGLVSAVNKMSAFFMDCKLSPNERATPDPDFKVGKSKILVGIMQFIKDVADPTSKIWMHNTKALMNHKIAAIQKLERSNNVNDETLESVLSSKGENLSEYLSYKYATKDEGREHRYTASTENFKNVKEKYQQMRGDALKTEILADFKDKLAEATDEQSLKQIVAELKSKDEYRILAKGQGLTTQLLGLKTSSVSSFEKMVEETRESIKSQERQTIKIK mint rab1a_human Ras-related protein Rab-1A YPT1-related protein RAB1A RAB1 protein protein human Homo sapiens Human MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC gdia_human Rab GDP dissociation inhibitor alpha GDI1 OPHN2 RABGDIA XAP4 Guanosine diphosphate dissociation inhibitor 1 Oligophrenin-2 Protein XAP-4 GDIL protein protein human Homo sapiens Human MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETVNRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQLICDPSYIPDRVRKAGQVIRIICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYIAIASTTVETTDPEKEVEPALELLEPIDQKFVAISDLYEPIDDGCESQVFCSCSYDATTHFETTCNDIKDIYKRMAGTAFDFENMKRKQNDVFGEAEQ drra-rab1a-1 895999 q5zsq3_legph SidM/DrrA 896004 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false rab1a_human Rab1 896005 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 895999 mint sf2b f6 drra-rab1a-2 895999 q5zsq3_legph SidM/DrrA 896004 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified rab1a_human Rab1 896005 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false 895999 sf2b mint drra-rab1a-3 895999 q5zsq3_legph SidM/DrrA 896004 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q5ZSQ3:p.Ala435Glu mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false rab1a_human Rab1 896005 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 895999 f3b mint drra-rab1a-4 896000 q5zsq3_legph SidM/DrrA 896004 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false rab1a_human Rab1 896005 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false mint sf5 drra-rab1a-5 896000 q5zsq3_legph SidM/DrrA 896004 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q5ZSQ3:p.Ala435Glu mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false rab1a_human Rab1 896005 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component partially purified partially purified physical association physical association false false false f2d mint drra-rab1a 896001 q5zsq3_legph SidM/DrrA 896004 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false rab1a_human Rab1 896005 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false mint st1 f1 sf1 drra-rab1a-6 896002 q5zsq3_legph SidM/DrrA 896004 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q5ZSQ3:p.Ala435Glu mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false rab1a_human Rab1 896005 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component partially purified partially purified physical association physical association false false false mint f2b f2d f3d rab1a-gdi1 896003 gdia_human GDI1 896006 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell rab1a_human Rab1 896005 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false homomint mint f2b f2d