MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint nekrasov-2009-2 Control of the pattern-recognition receptor EFR by an ER protein complex in plant immunity. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Nekrasov V., Li J., Batoux M., Roux M., Chu ZH., Lacombe S., Rougon A., Bittel P., Kiss-Papp M., Chinchilla D., van Esse HP., Jorda L., Schwessinger B., Nicaise V., Thomma BP., Molina A., Jones JD., Zipfel C. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation nekrasov-2009-1 Control of the pattern-recognition receptor EFR by an ER protein complex in plant immunity. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Nekrasov V., Li J., Batoux M., Roux M., Chu ZH., Lacombe S., Rougon A., Bittel P., Kiss-Papp M., Chinchilla D., van Esse HP., Jorda L., Schwessinger B., Nicaise V., Thomma BP., Molina A., Jones JD., Zipfel C. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation nekrasov-2009-4 Control of the pattern-recognition receptor EFR by an ER protein complex in plant immunity. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Nekrasov V., Li J., Batoux M., Roux M., Chu ZH., Lacombe S., Rougon A., Bittel P., Kiss-Papp M., Chinchilla D., van Esse HP., Jorda L., Schwessinger B., Nicaise V., Thomma BP., Molina A., Jones JD., Zipfel C. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation dnj19_arath DnaJ protein ERDJ3B ERDJ3B B19 Chaperone protein dnaJ 19 Endoplasmic reticulum dnaJ domain-containing protein 3B Protein SCJ1 homolog ERDJ3B F26K9.30 At3g62600 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAIRWSELCIVLFALSYAICVLAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFAEINNAYEVLSDEEKREIYNKYGEEGLKQFSANGGRGGGGGGMNMQDIFSSFFGGGSMEEEEKVVKGDDVIVELEATLEDLYMGGSMKVWREKNVIKPAPGKRKCNCRNEVYHRQIGPGMFQQMTEQVCDKCPNVKYEREGYFVTVDIEKGMKDGEEVSFYEDGEPILDGDPGDLKFRIRTAPHARFRRDGNDLHMNVNITLVEALVGFEKSFKHLDDHEVDISSKGITKPKEVKKFKGEGMPLHYSTKKGNLFVTFEVLFPSSLTDDQKKKIKEVFA mint bip1_arath Heat shock 70 kDa protein BIP1 BIP1 HSP70-11 Heat shock 70 kDa protein 11 Heat shock protein 70-11 Luminal-binding protein 1 MED37A MED37_5 T26D3.10 T26D3_50 At5g28540 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MARSFGANSTVVLAIIFFGCLFALSSAIEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSVLTIDNGVFEVLSTNGDTHLGGEDFDHRVMEYFIKLIKKKHQKDISKDNKALGKLRRECERAKRALSSQHQVRVEIESLFDGVDFSEPLTRARFEELNNDLFRKTMGPVKKAMDDAGLQKSQIDEIVLVGGSTRIPKVQQLLKDFFEGKEPNKGVNPDEAVAYGAAVQGGILSGEGGDETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTVSIQVFEGERSLTKDCRLLGKFDLNGIPPAPRGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKEKIDARNALETYVYNMKNQVNDKDKLADKLEGDEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITAVYQRSGGAPGGAGGESSTEEEDESHDEL bip2_arath Heat shock 70 kDa protein BIP2 Heat shock 70 kDa protein 12 Heat shock protein 70-12 Luminal-binding protein 2 MED37F MED37_6 MJC20.12 At5g42020 BIP2 BIP HSP70-12 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MARSFGANSTVVLAIIFFGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSVLTIDNGVFEVLSTNGDTHLGGEDFDHRIMEYFIKLIKKKHQKDISKDNKALGKLRRECERAKRALSSQHQVRVEIESLFDGVDLSEPLTRARFEELNNDLFRKTMGPVKKAMDDAGLQKSQIDEIVLVGGSTRIPKVQQLLKDFFEGKEPNKGVNPDEAVAYGAAVQGGILSGEGGDETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTVSIQVFEGERSLTKDCRLLGKFDLTGVPPAPRGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKEKIDARNALETYVYNMKNQVSDKDKLADKLEGDEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEVEAVCNPIITAVYQRSGGAPGAGGESSTEEEDESHDEL bip3_arath Heat shock 70 kDa protein BIP3 BIP3 BIP-L BiP chaperone BIP-L HSP70-13 Heat shock 70 kDa protein 13 Heat shock protein 70-13 Hsp70 protein BiP chaperone BIP-L Luminal-binding protein 3 MED37B MED37_1 F7G19.5 At1g09080 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MIFIKENTAKMTRNKAIACLVFLTVLDFLMNIGAALMSSLAIEGEEQKLGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGNRITPSWVAFTDTERLIGEAAKNQAAKNPERTIFDPKRLIGRKFDDPDVQRDIKFLPYKVVNKDGKPYIQVKVKGEEKLFSPEEISAMILTKMKETAEAFLGKKIKDAVITVPAYFNDAQRQATKDAGAIAGLNVVRIINEPTGAAIAYGLDKKGGESNILVYDLGGGTFDVSILTIDNGVFEVLSTSGDTHLGGEDFDHRVMDYFIKLVKKKYNKDISKDHKALGKLRRECELAKRSLSNQHQVRVEIESLFDGVDFSEPLTRARFEELNMDLFKKTMEPVKKALKDAGLKKSDIDEIVLVGGSTRIPKVQQMLKDFFDGKEPSKGTNPDEAVAYGAAVQGGVLSGEGGEETQNILLLDVAPLSLGIETVGGVMTNIIPRNTVIPTKKSQVFTTYQDQQTTVTINVYEGERSMTKDNRELGKFDLTGILPAPRGVPQIEVTFEVDANGILQVKAEDKVAKTSQSITITNDKGRLTEEEIEEMIREAEEFAEEDKIMKEKIDARNKLETYVYNMKSTVADKEKLAKKISDEDKEKMEGVLKEALEWLEENVNAEKEDYDEKLKEVELVCDPVIKSVYEKTEGENEDDDGDDHDEL mint dnj63_arath DnaJ protein ERDJ3A Protein THERMOSENSITIVE MALE STERILE 1 TMS1 T16O11.7 At3g08970 ERDJ3A A63 Chaperone protein dnaJ 63 Endoplasmic reticulum dnaJ domain-containing protein 3A Protein SCJ1 homolog ERDJ3A protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVRTRLAISVVLVSTLLLLNVKAKSVDPYKVLGVSKDAKQREIQKAFHKQSLKYHPDKNKDKGAQEKFAEINNAYEILSDEEKRKNYDLYGDEKGQPGFDSGFPGGNGGYSYSSSGGGFNFGGPGGWQNMGGGGGSKSFSFSFGGPSESSFGFGMDDIFSMFSGGSSKGKEQFGGFGSSSNAESKSKSSTVAAIKTINSQVYKKDVVDQGMTWLLLSYLPSQRGSQYHESIIEEVAESLQGALKVGRLNCETESSLCKQLGIVPRRAPRMFVYSYTSSGKATLAEYTEELVAKKVKSFCQEHLPRFSKKIDLNTFDVSAVSSQKTPKVLLLSTKKDTPVIWRVLSGLYNGRFVFYNTEVHDTSDPKIQKLGVDKFPAIVGWLSNGEKQVLKTGITVKNLKSAVQELGKLLEGLEKKNKKVSSKSQAGQAPNESSEKIPLLSRPNFDSICGENTPVCIIGAFRSSNGKEKLQSIMSKVSQKSLSRRQASTTGSQDTVSYSLLDATKQSAFLSSLDKSEFKTSSDKLLIAYKPRRGKFATFKGDMTIEEVEKFVAAVLNGDIQFTKTRQKPQIK mint sdf2_arath Stromal cell-derived factor 2-like protein SDF2 F13D4.70 At2g25110 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MALGFFCLAIFLYLSLDPDSGYTSASAAASGKEGVEITYGSAIKLMHEKTKFRLHSHDVPYGSGSGQQSVTGFPGVVDSNSYWIVKPVPGTTEKQGDAVKSGATIRLQHMKTRKWLHSHLHASPISGNLEVSCFGDDTNSDTGDHWKLIIEGSGKTWKQDQRVRLQHIDTSGYLHSHDKKYQRIAGGQQEVCGIREKKADNIWLAAEGVYLPLNESSK mint med37a-f26k9_30 960594 q9lzk5_arath ERdj3B 960597 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bip1_arath BiP1 960598 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f5d mint med37f-f26k9_30 960594 q9lzk5_arath ERdj3B 960597 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bip2_arath BiP2 960599 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint sf7 med37b-f26k9_30 960594 q9lzk5_arath ERdj3B 960597 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q8h1b3_arath BiP3 960600 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint sf7 med37b-t16o11_7 960594 q8h1b3_arath BiP3 960600 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q9sr96_arath ERdj3A 960601 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint sf7 med37a-t16o11_7 960594 q9sr96_arath ERdj3A 960601 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bip1_arath BiP1 960598 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f7 mint med37f-t16o11_7 960594 q9sr96_arath ERdj3A 960601 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bip2_arath BiP2 960599 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint sf7 f26k9_30-f26k9_30 960594 q9lzk5_arath ERdj3B 960597 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q9lzk5_arath SDF2 960597 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f5d mint f26k9_30-med37a 960594 q9lzk5_arath ERdj3B 960597 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bip1_arath BiP1 960598 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f5d mint f26k9_30-med37f 960594 q9lzk5_arath ERdj3B 960597 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bip2_arath BiP2 960599 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint sf7 f26k9_30-med37b 960594 q8h1b3_arath BiP3 960600 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q9lzk5_arath ERdj3B 960597 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint sf7 sdf2-f26k9_30 960595 q9lzk5_arath ERdj3B 960597 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level sdf2_arath SDF2 960602 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false f5c mint sdf2-f26k9_30-1 960595 sdf2_arath SDF2 960602 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q9lzk5_arath ERdj3B 960597 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false sf6 mint sdf2-2 960596 sdf2_arath SDF2 960602 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f5a mint