IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ amaro-2008-3 The Saccharomyces cerevisiae homolog of p24 is essential for maintaining the association of p150Glued with the dynactin complex. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Amaro IA., Costanzo M., Boone C., Huffaker TC. Tagged proteins may have been identified using anti-tag antibodies. tch4@cornell.edu Genetics (0016-6731) 2008 Only protein-protein interactions imex curation amaro-2008-1 The Saccharomyces cerevisiae homolog of p24 is essential for maintaining the association of p150Glued with the dynactin complex. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Amaro IA., Costanzo M., Boone C., Huffaker TC. Tagged proteins may have been identified using anti-tag antibodies. tch4@cornell.edu Genetics (0016-6731) 2008 Only protein-protein interactions imex curation amaro-2008-2 The Saccharomyces cerevisiae homolog of p24 is essential for maintaining the association of p150Glued with the dynactin complex. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Amaro IA., Costanzo M., Boone C., Huffaker TC. Tagged proteins may have been identified using anti-tag antibodies. tch4@cornell.edu Genetics (0016-6731) 2008 Only protein-protein interactions imex curation jnm1_yeast Nuclear migration protein JNM1 YMR294W JNM1 INS1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNVIDLSDPAINVDYDSLIGIDNEESQEIFENEVKEDGQQEEQEEASSRKDGLIVEPGRDVESLRRAIRDQLLFKIHRQNQSDCADARKLSNDEEDESRQQKLERIREELEELKIENLTSEMQTEIKELCEIQSKLATESSSRLTNLRKKLLETYEGQDTVILPNIILDTSNIKRLQKLDQKISLMERFVGIPEALEAEEDRKSVHSKVNELYRSIQLLQGDDKAEGKLQKFRDRLVELNEEFENSLLGKKIQQDLRLKDDTVSKLVMPENKVKEINSMYSMFKQYQDSLPLLAERMKSLNKMNNRVIEVYETTKGLDSQITSIQEQGKVWLKALNELDKKFDEQEVKIRENMEQIRRKIDTLEDEALQRNSK 80646B78B484AE56 arp1_yeast Centractin ARP1 ACT3 ACT5 Actin-like protein Actin-related protein 1 YHR129C protein protein yeast Saccharomyces cerevisiae Baker's yeast MDQLSDSYALYNQPVVIDNGSGIIKAGFSGEERPKALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGLLKLRYPIKHGVVEDWDSMELIWSYVLNEVLQLQNIGEHPLLITEAPMNPLKNREQMAQVLFETFDVSALYVSNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALPASMMRMDIGGADITEQLQFQLRKSAGVSLFSSSEREIVRTMKEKVCYLAKNIKKEEEKYLQGTQDLISTFKLPDGRCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILSGGTTTLKGFGDRMLWDLEALTKGTSKIKIIAPSERKYTTWIGGSILTGLSTFQRLWTKKSDWLEDSTRVYSNLM nip80_yeast Protein NIP100 YPL174C NIP100 NIP80 Protein NIP80 protein protein yeast Saccharomyces cerevisiae Baker's yeast MRNAGVQVDTNMQKISLQDTVLVNEMKGRVKFIGETQFAKGIWYGIELDKPLGKNDGSANGIRYFDIDLKKANSNGGYYGLFCKKDTLQFYKPDDDEHSLLNGNAAQETIKNLQVKCESLASKLNKIKIENHELKTSVEKLSTNETVLLSKISRLDKLVKELKVENGNMKTHLDNFNHLLDASDSVMAPDLDKGTLLERSHLLQGLLDQTKLSYDKAMKVQEDLLEENTQLLEENAVLSKKISDLGLQLQQTNNTIGDLALQIEAQSKSSNIVDKLTNDNILLTSNIKALNNELEELQAKEKLDENLRITYEQLEQELRLQLSNLQSALENEKEIAGTYIEENSRLKATLESIEAKTSHKFQSLELKVNTLQEELYQNKLLKKFYQIYEPFAQPHLAALSSQLQYLAEVIESENFGKLENIEIHIILKVLSSISYALHIYTIKNTPDHLETTLQCFKVNIAPISMWLSEFLQRKFSSKQETAFSICQFLEDNKFLDKDVTLILKILHPILETTVPKLLAFLRTNSNFNDNDTLCLIGSLYERSLSLIARIDKLIGKEEISKQDNRLFLYPSCDITLSSILTILFSDALFLRQDYKRISSLKKLEVFFQGIESLLENITIFPEQPSQQTSDSESQCNIKEGNFSNSLLSDRLNEENIRLKEVLVQKENMLTELETKIKIIIGRDLERKTLEENIKTLKVELNNKNEENCGKTEILNKLKEENFNLVNRLKNMELKLYQIKDNNTLNKIYLDREKVDRVNLVSEIMELRETIRRQIKEQKRVSIDFSWLDELPAVENKQPFKEHINHSLDTLGIEMFNFVSTSRILDLKLDQPLAEDELWHERDHSYISYLKRKRKNIRLKSQNVVTYYK A72EA9E938845081 arp10_yeast Actin-like protein ARP10 ARP10 YD8557.15 YD9727.02 YDR106W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNTIVIVYLGANRIEIGRSADACPQEIIAWKTGSINEKNREELKKIFEHYFQICNILGNREVQVLILEDIFISVVEKRIICSILFKEFDCAHVSFVPRAIVHCLSCNTRNAIVIDIGTNYTTCVPIFDLRPLQQFIKYSKRGKRQVESRIPLPGSLYMPIFFDEEYNSKNCEVDETPVINLVKNIVESLPIDLRRPLRENIIIVNIEEAYETVIRNLFKLKMDTSKIQFPKNYWQAGSACAKILLHYKGSNIVGIERDEFYNNPHIAPDWFDYYFRTGVKRLQ C2EDD2B6D4BE48BD ldb18_yeast Protein LDB18 Low dye-binding protein 18 LDB18 YLL049W protein protein yeast Saccharomyces cerevisiae Baker's yeast MPGLKLVEALEYRCDRLERLIGAGYSANSDVSVQLDELYNQLHRLYFQGLKYSQDLLQLFNTFMAEDIENVGAPDDICIFASCFDDIYTLYSAFDELNSQYMEFCQISKSSLDQISFKDANIETKQLKKLPELVDNCNIMILRSIAILNRFIDWNIEVNGFFQFQKKRLLNLQKVIYST arp1-jnm1-2 Interaction between arp1 and jnm1 determined by coimmunoprecipitation 881948 n/a 881951 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 881952 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5A arp1-jnm1-3 Interaction between arp1 and jnm1 determined by coimmunoprecipitation 881948 n/a 881951 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 881953 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figs. 5B, 5B Interaction is reduced in a ldb18 -/- strain. ldb18-nip100-1 Interaction between ldb1, nip100, arp1, arp10 and jnm1 identified by coimmunoprecipitation 881949 n/a 881952 unspecified role unspecified role prey prey n/a 881951 unspecified role unspecified role prey prey n/a 881954 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 881953 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 881955 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2B ldb18-nip100-2 Interaction between ldb1, nip100, arp1 and jnm1 identified by cosedimentation 881950 n/a 881955 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 881952 unspecified role unspecified role neutral component neutral component n/a 881951 unspecified role unspecified role neutral component neutral component n/a 881953 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2C Approximately 20 S complex.