I2D I2D carriba-2007-2 Striatal adenosine A2A and cannabinoid CB1 receptors form functional heteromeric complexes that mediate the motor effects of cannabinoids. rat-brain-striatum Rattus norvegicus brian stiatum brain_striatum Brain striatum, Neostratum. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Carriba P., Ortiz O., Patkar K., Justinova Z., Stroik J., Themann A., Muller C., Woods AS., Hope BT., Ciruela F., Casado V., Canela EI., Lluis C., Goldberg SR., Moratalla R., Franco R., Ferre S. sferre@intra.nida.nih.gov Neuropsychopharmacology (0893-133X) 2007 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database carriba-2007-1 Striatal adenosine A2A and cannabinoid CB1 receptors form functional heteromeric complexes that mediate the motor effects of cannabinoids. rat-brain-striatum Rattus norvegicus brian stiatum brain_striatum Brain striatum, Neostratum. confocal microscopy confocal microscopy immunostaining immunostaining Carriba P., Ortiz O., Patkar K., Justinova Z., Stroik J., Themann A., Muller C., Woods AS., Hope BT., Ciruela F., Casado V., Canela EI., Lluis C., Goldberg SR., Moratalla R., Franco R., Ferre S. sferre@intra.nida.nih.gov Neuropsychopharmacology (0893-133X) 2007 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database carriba-2007-3 Striatal adenosine A2A and cannabinoid CB1 receptors form functional heteromeric complexes that mediate the motor effects of cannabinoids. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Carriba P., Ortiz O., Patkar K., Justinova Z., Stroik J., Themann A., Muller C., Woods AS., Hope BT., Ciruela F., Casado V., Canela EI., Lluis C., Goldberg SR., Moratalla R., Franco R., Ferre S. sferre@intra.nida.nih.gov Neuropsychopharmacology (0893-133X) 2007 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database carriba-2007-4 Striatal adenosine A2A and cannabinoid CB1 receptors form functional heteromeric complexes that mediate the motor effects of cannabinoids. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret tag fluorescence tag visualisation by fluorescence tag fluorescence Carriba P., Ortiz O., Patkar K., Justinova Z., Stroik J., Themann A., Muller C., Woods AS., Hope BT., Ciruela F., Casado V., Canela EI., Lluis C., Goldberg SR., Moratalla R., Franco R., Ferre S. sferre@intra.nida.nih.gov Neuropsychopharmacology (0893-133X) 2007 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database carriba-2007-5 Striatal adenosine A2A and cannabinoid CB1 receptors form functional heteromeric complexes that mediate the motor effects of cannabinoids. human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells confocal microscopy confocal microscopy immunostaining immunostaining Carriba P., Ortiz O., Patkar K., Justinova Z., Stroik J., Themann A., Muller C., Woods AS., Hope BT., Ciruela F., Casado V., Canela EI., Lluis C., Goldberg SR., Moratalla R., Franco R., Ferre S. sferre@intra.nida.nih.gov Neuropsychopharmacology (0893-133X) 2007 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database aa2ar_rat Adenosine receptor A2a Adora2a protein protein rat Rattus norvegicus (Rat) Rat MGSSVYITVELAIAVLAILGNVLVCWAVWINSNLQNVTNFFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGVRAKGIIAICWVLSFAIGLTPMLGWNNCSQKDGNSTKTCGEGRVTCLFEDVVPMNYMVYYNFFAFVLLPLLLMLAIYLRIFLAARRQLKQMESQPLPGERTRSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCSTCRHAPPWLMYLAIILSHSNSVVNPFIYAYRIREFRQTFRKIIRTHVLRRQEPFQAGGSSAWALAAHSTEGEQVSLRLNGHPLGVWANGSATHSGRRPNGYTLGLGGGGSAQGSPRDVELPTQERQEGQEHPGLRGHLVQARVGASSWSSEFAPS cnr1_rat Cannabinoid receptor 1 Cnr1 Skr6 Brain-type cannabinoid receptor protein protein rat Rattus norvegicus (Rat) Rat MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEENIQCGENFMDMECFMILNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL aa2ar_human Adenosine receptor A2a ADORA2A ADORA2 protein protein human Homo sapiens Human MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS cnr1_human Cannabinoid receptor 1 CNR1 CNR CANN6 protein protein human Homo sapiens Human MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL cb1-adora2-2 976941 n/a 976946 unspecified role unspecified role prey prey n/a 976947 unspecified role unspecified role bait bait physical association physical association false false false Fig.3 cb1-adora2-3 976941 n/a 976946 unspecified role unspecified role bait bait n/a 976947 unspecified role unspecified role prey prey physical association physical association false false false Fig.3 cb1-adora2-1 976942 n/a 976946 unspecified role unspecified role neutral component neutral component n/a 976947 acceptor acceptor neutral component neutral component colocalization colocalization false false false Fig.2 cb1-adora2-4 976943 n/a 976948 unspecified role unspecified role neutral component neutral component region renilla luciferase renilla luciferase protein tag renilla luciferase undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 976949 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 4a cb1-adora2-5 976944 n/a 976948 unspecified role unspecified role fluorescence donor fluorescence donor region renilla luciferase renilla luciferase protein tag renilla luciferase undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 976949 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false proximity proximity close-contact colocalization neighbourhood interaction false false false Fig. 4b cb1-adora2-6 976945 n/a 976948 unspecified role unspecified role neutral component neutral component n/a 976949 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 5b