MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint b_guin-2005-1 14-3-3 and calmodulin control subcellular distribution of Kir/Gem and its regulation of cell shape and calcium channel activity. unknown Unknown pull down pull down predetermined predetermined participant predetermined Béguin P., Mahalakshmi RN., Nagashima K., Cher DH., Takahashi A., Yamada Y., Seino Y., Hunziker W. beguinp@imcb.a-star.edu.sg J. Cell. Sci. (0021-9533) 2005 partial coverage rapid curation gem_mouse GTP-binding protein GEM Gem Kir GTP-binding mitogen-induced T-cell protein RAS-like protein KIR protein protein mouse Mus musculus Mouse MTLNNVTMRQGTVGMQPQQRWSIPADARHLMVQKDPHPCNLRNRHSTAPEEHCRRSWSSDSTDSVISSESGNTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLVVDGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACAVVFDCKFIETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRRESIPRKARRFWGKIVAKNNKNMAFKLKSKSCHDLSVL mint Could be a regulatory protein, possibly participating in receptor-mediated signal transduction at the plasma membrane. Has guanine nucleotide-binding activity but undetectable intrinsic GTPase activity 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN gem-ywhab-4 984657 gem_mouse GEM_MOUSE 984658 unspecified role unspecified role unspecified role unspecified role 1433b_human 1433B_HUMAN 984659 unspecified role unspecified role unspecified role unspecified role association association false false false homomint domino mint gem-ywhab-5 984657 gem_mouse GEM_MOUSE 984658 unspecified role unspecified role unspecified role unspecified role 1433b_human 1433B_HUMAN 984659 unspecified role unspecified role unspecified role unspecified role association association false false false homomint domino mint