MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint cui-2010b-2 A subunit of decaprenyl diphosphate synthase stabilizes octaprenyl diphosphate synthase in Escherichia coli by forming a high-molecular weight complex. in vitro In vitro bn-page blue native page bn-page predetermined predetermined participant predetermined Cui TZ., Kaino T., Kawamukai M. FEBS Lett. (0014-5793) 2010 Only protein-protein interactions imex curation cui-2010b-1 A subunit of decaprenyl diphosphate synthase stabilizes octaprenyl diphosphate synthase in Escherichia coli by forming a high-molecular weight complex. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Cui TZ., Kaino T., Kawamukai M. FEBS Lett. (0014-5793) 2010 Only protein-protein interactions imex curation ispb_ecoli Octaprenyl diphosphate synthase yhbD Octaprenyl pyrophosphate synthase ispB cel b3187 JW3154 All-trans-octaprenyl-diphosphate synthase protein protein ecoli Escherichia coli (strain K12) MNLEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVGYEGNAHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRAFQMMTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARLFEAAAQCSGILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEGKPTLPLLHAMHHGTPEQAQMIRTAIEQGNGRHLLEPVLEAMNACGSLEWTRQRAEEEADKAIAALQVLPDTPWREALIGLAHIAVQRDR dps1_schpo Decaprenyl-diphosphate synthase subunit 1 dps1 dps SPBPJ4664.01 SPBPJ694.01 All-trans-decaprenyl-diphosphate synthase subunit 1 Decaprenyl pyrophosphate synthase subunit 1 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MIQYVYLKHMRKLWSLGKVRSTVLRFSTTNRNASHLIKNELEQISPGIRQMLNSNSEFLEECSKYYTIAQGKQMRPSLVLLMSKATSLCHGIDRSVVGDKYIDDDDLRSFSTGQILPSQLRLAQITEMIHIASLLHDDVIDHANVRRGSPSSNVAFGNRRSILAGNFILARASTAMARLRNPQVTELLATVIADLVRGEFLQLKNTMDPSSLEIKQSNFDYYIEKSFLKTASLISKSCKASTILGQCSPTVATAAGEYGRCIGTAFQLMDDVLDYTSKDDTLGKAAGADLKLGLATAPVLFAWKKYPELGAMIVNRFNHPSDIQRARSLVECTDAIEQTITWAKEYIKKAKDSLLCLPDSPARKALFALADKVITRKK mint Supplies decaprenyl diphosphate, the precursor for the side chain of the isoprenoid quinones ubiquinone-10 dlp1_schpo Decaprenyl-diphosphate synthase subunit 2 dlp1 All-trans-decaprenyl-diphosphate synthase subunit 2 Decaprenyl pyrophosphate synthase subunit 2 SPAC19G12.12 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSFPFASLLKRPSAISSLLSLKKPGSWSSILLKAVGVLSRDSRWHSDLLKMLTEEMDSLNGQINTWTDNNPLLDEITKPYRKSSTRFFHPLLVLLMSRASVNGDPPSQQLFQRYKQLARVTELIHAANIIHINIGEEQSNEQIKLATLVGDYLLGKASVDLAHLENNAITEIMASVIANLVEGHFGSRQNGSVGLSNERTILLQSAFMPAKACLCASILNNSSQYINDACFNYGKFLGLSLQLAHKPVSPDAQVLQKNNDILKTYVENAKSSLSVFPDIEAKQALMEIANSVSK mint Supplies decaprenyl diphosphate, the precursor for the side chain of the isoprenoid quinones ubiquinone-10 dlp1_human All trans-polyprenyl-diphosphate synthase PDSS2 Decaprenyl-diphosphate synthase subunit 2 Solanesyl-diphosphate synthase subunit 2 All-trans-decaprenyl-diphosphate synthase subunit 2 Decaprenyl pyrophosphate synthase subunit 2 PDSS2 C6orf210 DLP1 Candidate tumor suppressor protein protein protein human Homo sapiens Human MNFRQLLLHLPRYLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIVGYPTSFMSLRCLLSDELSNIAMQVRKLVGTQHPLLTTARGLVHDSWNSLQLRGLVVLLISKAAGPSSVNTSCQNYDMVSGIYSCQRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKDMQFGNKIAILSGDFLLANACNGLALLQNTKVVELLASALMDLVQGVYHENSTSKESYITDDIGISTWKEQTFLSHGALLAKSCQAAMELAKHDAEVQNMAFQYGKHMAMSHKINSDVQPFIKEKTSDSMTFNLNSAPVVLHQEFLGRDLWIKQIGEAQEKGRLDYAKLRERIKAGKGVTSAIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS mint Supplies decaprenyl diphosphate, the precursor for the side chain of the isoprenoid quinones ubiquinone-10 homomint ispb-1 867783 ispb_ecoli IspB 867785 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 4.0 direct interaction direct interaction false false false f5a mint ispb-1 867783 ispb_ecoli IspB 867785 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 4.0 direct interaction direct interaction false false false f5a mint dps1-ispb 867783 dps1_schpo DSP1 867786 anti tag western anti tag western blot anti tag western unspecified role unspecified role neutral component neutral component partially purified partially purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ispb_ecoli IspB 867785 weight identificat confirmation by molecular weight weight identificat unspecified role unspecified role neutral component neutral component partially purified partially purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f5b mint dlp1-ispb 867783 dlp1_schpo DLP1 867787 anti tag western anti tag western blot anti tag western unspecified role unspecified role neutral component neutral component partially purified partially purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ispb_ecoli IspB 867785 weight identificat confirmation by molecular weight weight identificat unspecified role unspecified role neutral component neutral component partially purified partially purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f5b mint ispb-pdss2 867783 dlp1_human DLP1 867788 anti tag western anti tag western blot anti tag western unspecified role unspecified role neutral component neutral component partially purified partially purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ispb_ecoli IspB 867785 weight identificat confirmation by molecular weight weight identificat unspecified role unspecified role neutral component neutral component partially purified partially purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f5b mint ispb-dps1 867784 dps1_schpo DSP1 867786 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ispb_ecoli IspB 867785 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P0AD57:p.Arg321Ala mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f4a mint ispb-dlp1 867784 dlp1_schpo Dlp1 867787 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ispb_ecoli IspB 867785 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P0AD57:p.Arg321Ala mutation increasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f4b mint