MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint an-2010-1 Proteolytic activation and function of the cytokine Spatzle in the innate immune response of a lepidopteran insect, Manduca sexta. in vitro In vitro comigration in gel comigration in gel electrophoresis comigration in gel predetermined predetermined participant predetermined An C., Jiang H., Kanost MR. FEBS J. (1742-464X) 2010 Only protein-protein interactions imex curation c8bmd1_manse Spz1A protein protein manse Manduca sexta (Tobacco hawkmoth) Tobacco hornworm Tobacco hawkmoth MAWIQHLLVWLFVMSTSAYKCKDCFSFASQYPSYDSQVYEQPDRRIAGRSAQYEHLRTNERSLPVYSETQRIQAEERRRHSSRLEEPRQRAENGSYKILNNPPKPCITNRRSQIDSSNDRVVFPGPTSERSYVPEVPEECKKIGICDSIPNYPEEHVANIISRLGDKGKVLQIDELDVSDTPDIAQRLGPQEDNMELCSFREKIFYPKAAPDKDGNWFFVVNSKENPVQGYKVEICDRQQLPCAEFASFQQGYEARCIQKYVRRTMLALDPKGQMTDMPLKVPSCCSCVAKLTII mint spz1a 860324 c8bmd1_manse Spätzle 1A 860325 weight identificat confirmation by molecular weight weight identificat unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false mint F5A F7