MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint yuchi-2009-1 An engineered right-handed coiled coil domain imparts extreme thermostability to the KcsA channel. in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Yuchi Z., Pau VP., Lu BX., Junop M., Yang DS. FEBS J. (1742-464X) 2009 Only protein-protein interactions imex curation yuchi-2009-2 An engineered right-handed coiled coil domain imparts extreme thermostability to the KcsA channel. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yuchi Z., Pau VP., Lu BX., Junop M., Yang DS. FEBS J. (1742-464X) 2009 Only protein-protein interactions imex curation kcsa_strli pH-gated potassium channel KcsA Streptomyces lividans K+ channel kcsA skc1 protein protein strli Streptomyces lividans MPPMLSGLLARLVKLLLGRHGSALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGHFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR mint kcsa 853619 kcsa_strli kcsA 853621 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction false false false mint f4B kcsa-1 853620 kcsa_strli kcsA 853621 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction false false false mint f4A