MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint kish_trier-2009-1 Interaction of the Thermoplasma acidophilum A1A0-ATP synthase peripheral stalk with the catalytic domain. in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Kish-Trier E., Wilkens S. FEBS Lett. (0014-5793) 2009 Only protein-protein interactions imex curation vatb_theac V-type ATP synthase beta chain atpB V-ATPase subunit B Ta0005 protein protein theac Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) MPKLAYKSVSQISGPLLFVENVPNAAYNEMVDIELENGETRQGQVLDTRKGLAIVQIFGATTGIGTQGTTVKFRGETARLPISEDMLGRVFNGIGEPIDGGPEIIAKERMEITSNAINPYSREEPSEFIETGISAIDGMNTLVRGQKLPIFSGSGLPHNQLAAQIARQAKVLDSSENFAVVFGAMGITSEEANYFTNQFRETGALSRSVMFLNLSSDPSMERIILPRIALTTAEYLAFQKGMHILVILTDMTNYCEALREISAAREEVPGRRGYPGYMYTDLSTIYERAGKLKGNNGSITQIPILTMPGDDITHPVPDLTGYITEGQIVISRDLNRKDMYPGIDVLLSLSRLMNQGIGKGRTREDHRGLADQLYAAYASGKDLRSLTAIVGEEALSQNDRKYLHFADTFESRYIKQGFFEDRSIEDTLGLGWDLLADLPVQDMKRVKPDHIQKYGRWKKE mint vate_theac V-type ATP synthase subunit E atpE V-ATPase subunit E Ta0001 protein protein theac Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) MSLEEVLKDIERDKEEKKKEIADAASRETAKIEKEREEKIQILQREYENRMREEGSRLYNSIIDKANVEARNIVRMRVQEILDQYGAKADELIKNLAKTKEYDDVLKKMIEVSRKALGPDCIVKVNTADKGRISDGNIKFEDIDPYGGVLATSRDGKIELDLRISSIRRDILERFKVRLYSMIED mint v-atpase subunit h V-ATPase subunit H protein protein theac Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) mint atpb-atpe-1 853704 vatb_theac Bnt 853705 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified vate_theac Ect1 853706 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false v-atpase subunit h Hct 853707 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false F2 F3 mint