MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint tr_mpler-2009-1 Calpain-mediated degradation of reversibly oxidized protein-tyrosine phosphatase 1B. in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Trümpler A., Schlott B., Herrlich P., Greer PA., Böhmer FD. FEBS J. (1742-464X) 2009 Only protein-protein interactions imex curation trumpler-2009-1 Calpain-mediated degradation of reversibly oxidized protein-tyrosine phosphatase 1B. in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined Trümpler A., Schlott B., Herrlich P., Greer PA., Böhmer FD. FEBS J. (1742-464X) 2009 Only protein-protein interactions imex curation can1_human Calpain-1 catalytic subunit CAPN1 CANPL1 Calpain-1 large subunit Calcium-activated neutral proteinase 1 Calpain mu-type Micromolar-calpain Cell proliferation-inducing gene 30 protein PIG30 protein protein human Homo sapiens Human MSEEIITPVYCTGVSAQVQKQRARELGLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEAFPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILKALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQVVSLIRMRNPWGEVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKSRTIRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLDETDDPDDYGDRESGCSFVLALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPAVHLKRDFFLANASRARSEQFINLREVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTVELDDQIQANLPDEQVLSEEEIDENFKALFRQLAGEDMEISVKELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRDGNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELIITRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA ptn1_human Tyrosine-protein phosphatase non-receptor type 1 PTPN1 PTP1B Protein-tyrosine phosphatase 1B protein protein human Homo sapiens Human MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT cpns1_human Calpain small subunit 1 Calcium-dependent protease small subunit 1 Calcium-dependent protease small subunit Calpain regulatory subunit Calcium-activated neutral proteinase small subunit CAPNS1 CAPN4 CAPNS protein protein human Homo sapiens Human MFLVNSFLKGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMRILGGVISAISEAAAQYNPEPPPPRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS capn1-capns1 836790 can1_human Calpain 1 836792 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified ptn1_human PTP1B 836793 weight by staining molecular weight estimation by staining weight by staining enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cpns1_human Calpain 4 836794 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified cleavage cleavage reaction cleavage false false false homomint mint f1b f2c Authors used micro-calpain from human erythrocytes, which is a heterodimer of calpain-1 (gene name CAPN1, uniprot P07384) and the small regulatory subunit calpain-4 (gene name CAPNS1 (CAPN4) , uniprot P04632). capn1-capns1-1 836790 cpns1_human Calpain 4 836794 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ptn1_human PTP1B 836793 western blot western blot Immuno blot Immuno blot enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P18031:p.Cys215Ser mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false can1_human Calpain 1 836792 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified cleavage cleavage reaction cleavage false false false homomint mint f1c f2c Authors used micro-calpain from human erythrocytes, which is a heterodimer of calpain-1 (gene name CAPN1, uniprot P07384) and the small regulatory subunit calpain-4 (gene name CAPNS1 (CAPN4) , uniprot P04632). ptpn1-capn1 836791 cpns1_human Calpain 4 836794 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified can1_human Calpain 1 836792 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified ptn1_human PTP1B 836793 antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey purified purified P18031:p.Cys215Ser mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f4 homomint mint Authors used micro-calpain from human erythrocytes, which is a heterodimer of calpain-1 (gene name CAPN1, uniprot P07384) and the small regulatory subunit calpain-4 (gene name CAPNS1 (CAPN4) , uniprot P04632).