MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint kovac-2009-1 Definition of the residues required for the interaction between glycine-extended gastrin and transferrin in vitro. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Kovac S., Ferrand A., Estève JP., Mason AB., Baldwin GS. FEBS J. (1742-464X) 2009 kovac-2009-2 Definition of the residues required for the interaction between glycine-extended gastrin and transferrin in vitro. in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Kovac S., Ferrand A., Estève JP., Mason AB., Baldwin GS. FEBS J. (1742-464X) 2009 kovac-2009-3 Definition of the residues required for the interaction between glycine-extended gastrin and transferrin in vitro. in vitro In vitro competition binding competition binding predetermined predetermined participant predetermined Kovac S., Ferrand A., Estève JP., Mason AB., Baldwin GS. FEBS J. (1742-464X) 2009 trfe_human Serotransferrin Siderophilin Beta-1 metal-binding globulin TF PRO1400 protein protein human Homo sapiens Human MRLAVGALLVCAVLGLCLAVPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPEAPTDECKPVKWCALSHHERLKCDEWSVNSVGKIECVSAETTEDCIAKIMNGEADAMSLDGGFVYIAGKCGLVPVLAENYNKSDNCEDTPEAGYFAIAVVKKSASDLTWDNLKGKKSCHTAVGRTAGWNIPMGLLYNKINHCRFDEFFSEGCAPGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGAFRCLVEKGDVAFVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNHAVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSETKDLLFRDDTVCLAKLHDRNTYEKYLGEEYVKAVGNLRKCSTSSLLEACTFRRP gast_human Gastrin GAST GAS protein protein human Homo sapiens Human MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN gast-tf 829891 trfe_human Apo-transferrin 829894 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified apo trasferrin Apo trasferrin polyprotein frag polyprotein fragment polyprotein frag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false gast_human Gamide 829895 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gastrin 17 gastrin 17 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false other modification uncategorized protein modification uncategorized protein modification undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false prerequisite-ptm direct interaction direct interaction false false false homomint mint F1A F2 gast-tf-1 829891 gast_human Ggly 829895 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gastrin 17 gastrin 17 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false trfe_human Apo-transferrin 829894 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified apo trasferrin Apo trasferrin polyprotein frag polyprotein fragment polyprotein frag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false homomint mint F1A F2 gast-tf-2 829892 gast_human Ggly 829895 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gastrin 17 gastrin 17 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false trfe_human Apo-transferrin 829894 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified apo trasferrin Apo trasferrin polyprotein frag polyprotein fragment polyprotein frag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P02787:p.Tyr115Phe mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 829892 homomint mint F1C F4 gast-tf-3 829892 trfe_human Apo-transferrin 829894 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false apo trasferrin Apo trasferrin polyprotein frag polyprotein fragment polyprotein frag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false gast_human Ggly 829895 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gastrin 17 gastrin 17 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 829892 homomint mint F1C F4 gast-tf-4 829893 trfe_human Apo-transferrin 829894 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified apo trasferrin Apo trasferrin polyprotein frag polyprotein fragment polyprotein frag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false gast_human Ggly 829895 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P01350:p.Glu81Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false gastrin 17 gastrin 17 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false F3A homomint mint