MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint kostelec-2009-3 Recognition of an intra-chain tandem 14-3-3 binding site within PKCepsilon. unknown Unknown x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kostelecky B., Saurin AT., Purkiss A., Parker PJ., McDonald NQ. EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation kostelecky-2009-1 Recognition of an intra-chain tandem 14-3-3 binding site within PKCepsilon. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Kostelecky B., Saurin AT., Purkiss A., Parker PJ., McDonald NQ. EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation kostelec-2009-1 Recognition of an intra-chain tandem 14-3-3 binding site within PKCepsilon. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Kostelecky B., Saurin AT., Purkiss A., Parker PJ., McDonald NQ. EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation kostelec-2009-2 Recognition of an intra-chain tandem 14-3-3 binding site within PKCepsilon. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kostelecky B., Saurin AT., Purkiss A., Parker PJ., McDonald NQ. EMBO Rep. (1469-221X) 2009 Only protein-protein interactions imex curation kpce_human Protein kinase C epsilon type nPKC-epsilon PRKCE PKCE protein protein human Homo sapiens Human MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKTNSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLEPEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVNMPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIAKVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFGKVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN prkce-ywhaz-3 854956 kpce_human KPCE_HUMAN 854960 unspecified role unspecified role unspecified role unspecified role 1433z_human 1433Z_HUMAN 854961 unspecified role unspecified role unspecified role unspecified role association association false false false homomint domino mint prkce-ywhaz-4 854956 kpce_human KPCE_HUMAN 854960 unspecified role unspecified role unspecified role unspecified role 1433z_human 1433Z_HUMAN 854961 unspecified role unspecified role unspecified role unspecified role association association false false false homomint domino mint prkce-ywhaz 854957 1433z_human 14-3-3 zeta 854961 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified kpce_human PKC-epsilon 854960 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false F1B homomint domino mint prkce-ywhaz-1 854958 1433z_human 14-3-3 zeta 854961 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified kpce_human PKC-epsilon 854960 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false 854958 F1C homomint domino mint prkce-ywhaz-2 854959 1433z_human 14-3-3 zeta 854961 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified kpce_human PKC-epsilon 854960 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false ST1 homomint domino mint