IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ jang-2009-1 Genetic and spatial interactions between FT, TSF and SVP during the early stages of floral induction in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Jang S., Torti S., Coupland G. The authors do not provide cultivar information for the Rice proteins used in this study. Therefore the protein accession numbers identifying these proteins could not be unambiguously identified and since this was the case interactions involving these proteins were not curated. coupland@mpiz-koeln.mpg.de Plant J. (0960-7412) 2009 Only protein-protein interactions imex curation fd_arath Protein FD bZIP transcription factor 14 FD BZIP14 T19K4.30 F4B14.170 At4g35900 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MLSSAKHQRNHRLSATNKNQTLTKVSSISSSSPSSSSSSSSTSSSSPLPSQDSQAQKRSLVTMEEVWNDINLASIHHLNRHSPHPQHNHEPRFRGQNHHNQNPNSIFQDFLKGSLNQEPAPTSQTTGSAPNGDSTTVTVLYSSPFPPPATVLSLNSGAGFEFLDNQDPLVTSNSNLHTHHHLSNAHAFNTSFEALVPSSSFGKKRGQDSNEGSGNRRHKRMIKNRESAARSRARKQAYTNELELEVAHLQAENARLKRQQDQLKMAAAIQQPKKNTLQRSSTAPF ft_arath Protein FLOWERING LOCUS T FT At1g65480 F5I14.3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSINIRDPLIVSRVVGDVLDPFNRSITLKVTYGQREVTNGLDLRPSQVQNKPRVEIGGEDLRNFYTLVMVDPDVPSPSNPHLREYLHWLVTDIPATTGTTFGNEIVCYENPSPTAGIHRVVFILFRQLGRQTVYAPGWRQNFNTREFAEIYNLGLPVAAVFYNCQRESGCGGRRL tsf_arath Protein TWIN SISTER of FT At4g20370 TSF TFL1-like protein F9F13.20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSLSRRDPLVVGSVVGDVLDPFTRLVSLKVTYGHREVTNGLDLRPSQVLNKPIVEIGGDDFRNFYTLVMVDPDVPSPSNPHQREYLHWLVTDIPATTGNAFGNEVVCYESPRPPSGIHRIVLVLFRQLGRQTVYAPGWRQQFNTREFAEIYNLGLPVAASYFNCQRENGCGGRRT fdp_arath bZIP transcription factor 27 FDP BZIP27 Protein FD PARALOG T17A5.15 At2g17770 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MLSSAKHNKINNHSAFSISSSSSSLSTSSSLGHNKSQVTMEEVWKEINLGSLHYHRQLNIGHEPMLKNQNPNNSIFQDFLNMPLNQPPPPPPPPSSSTIVTALYGSLPLPPPATVLSLNSGVGFEFLDTTENLLASNPRSFEESAKFGCLGKKRGQDSDDTRGDRRYKRMIKNRESAARSRARKQAYTNELELEIAHLQTENARLKIQQEQLKIAEATQNQVKKTLQRSSTAPF ft-fd 855295 n/a 855296 unspecified role unspecified role prey prey n/a 855297 unspecified role unspecified role bait bait physical association physical association false false false Figure 4a tsf-fd 855295 n/a 855298 unspecified role unspecified role bait bait n/a 855296 unspecified role unspecified role prey prey physical association physical association false false false Figure 4a tsf-fdp 855295 n/a 855298 unspecified role unspecified role bait bait n/a 855299 unspecified role unspecified role prey prey physical association physical association false false false Figure 4b ft-fdp 855295 n/a 855299 unspecified role unspecified role prey prey n/a 855297 unspecified role unspecified role bait bait physical association physical association false false false Figure 4b