IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ fekairi-2009-2 Human SLX4 is a Holliday junction resolvase subunit that binds multiple DNA repair/recombination endonucleases. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Fekairi S., Scaglione S., Chahwan C., Taylor ER., Tissier A., Coulon S., Dong MQ., Ruse C., Yates JR., Russell P., Fuchs RP., McGowan CH., Gaillard PH. Tagged bait proteins identified by anti-tag antibodies. gaillard@ifr88.cnrs-mrs.fr Cell (0092-8674) 2009 Only protein-protein interactions 13 imex curation fekairi-2009-1 Human SLX4 is a Holliday junction resolvase subunit that binds multiple DNA repair/recombination endonucleases. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fekairi S., Scaglione S., Chahwan C., Taylor ER., Tissier A., Coulon S., Dong MQ., Ruse C., Yates JR., Russell P., Fuchs RP., McGowan CH., Gaillard PH. gaillard@ifr88.cnrs-mrs.fr Cell (0092-8674) 2009 Only protein-protein interactions 13 imex curation fekairi-2009-3 Human SLX4 is a Holliday junction resolvase subunit that binds multiple DNA repair/recombination endonucleases. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Fekairi S., Scaglione S., Chahwan C., Taylor ER., Tissier A., Coulon S., Dong MQ., Ruse C., Yates JR., Russell P., Fuchs RP., McGowan CH., Gaillard PH. gaillard@ifr88.cnrs-mrs.fr Cell (0092-8674) 2009 Only protein-protein interactions 13 imex curation fekairi-2009-4 Human SLX4 is a Holliday junction resolvase subunit that binds multiple DNA repair/recombination endonucleases. human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Fekairi S., Scaglione S., Chahwan C., Taylor ER., Tissier A., Coulon S., Dong MQ., Ruse C., Yates JR., Russell P., Fuchs RP., McGowan CH., Gaillard PH. Further details on experiment were taken from PMID: 19596236 however in neither publication was the cell line given that proteins were immunoprecipitated from. It can be inferred that they were of human origin, as protein were identified by accession number. gaillard@ifr88.cnrs-mrs.fr Cell (0092-8674) 2009 Only protein-protein interactions 13 imex curation fekairi-2009-5 Human SLX4 is a Holliday junction resolvase subunit that binds multiple DNA repair/recombination endonucleases. human-mrc5 Human foetal lung fibroblast-like cell line mrc5 Human foetal lung fibroblast-like cell line confocal microscopy confocal microscopy immunostaining immunostaining Fekairi S., Scaglione S., Chahwan C., Taylor ER., Tissier A., Coulon S., Dong MQ., Ruse C., Yates JR., Russell P., Fuchs RP., McGowan CH., Gaillard PH. gaillard@ifr88.cnrs-mrs.fr Cell (0092-8674) 2009 Only protein-protein interactions 13 imex curation xpf_human DNA repair endonuclease XPF ERCC4 ERCC11 XPF DNA excision repair protein ERCC-4 DNA repair protein complementing XP-F cells Xeroderma pigmentosum group F-complementing protein protein protein human Homo sapiens Human MESGQPARRIAMAPLLEYERQLVLELLDTDGLVVCARGLGADRLLYHFLQLHCHPACLVLVLNTQPAEEEYFINQLKIEGVEHLPRRVTNEITSNSRYEVYTQGGVIFATSRILVVDFLTDRIPSDLITGILVYRAHRIIESCQEAFILRLFRQKNKRGFIKAFTDNAVAFDTGFCHVERVMRNLFVRKLYLWPRFHVAVNSFLEQHKPEVVEIHVSMTPTMLAIQTAILDILNACLKELKCHNPSLEVEDLSLENAIGKPFDKTIRHYLDPLWHQLGAKTKSLVQDLKILRTLLQYLSQYDCVTFLNLLESLRATEKAFGQNSGWLFLDSSTSMFINARARVYHLPDAKMSKKEKISEKMEIKEGEETKKELVLESNPKWEALTEVLKEIEAENKESEALGGPGQVLICASDDRTCSQLRDYITLGAEAFLLRLYRKTFEKDSKAEEVWMKFRKEDSSKRIRKSHKRPKDPQNKERASTKERTLKKKKRKLTLTQMVGKPEELEEEGDVEEGYRREISSSPESCPEEIKHEEFDVNLSSDAAFGILKEPLTIIHPLLGCSDPYALTRVLHEVEPRYVVLYDAELTFVRQLEIYRASRPGKPLRVYFLIYGGSTEEQRYLTALRKEKEAFEKLIREKASMVVPEEREGRDETNLDLVRGTASADVSTDTRKAGGQEQNGTQQSIVVDMREFRSELPSLIHRRGIDIEPVTLEVGDYILTPEMCVERKSISDLIGSLNNGRLYSQCISMSRYYKRPVLLIEFDPSKPFSLTSRGALFQEISSNDISSKLTLLTLHFPRLRILWCPSPHATAELFEELKQSKPQPDAATALAITADSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVSKGKGKK slx4_human Structure-specific endonuclease subunit SLX4 SLX4 BTB/POZ domain-containing protein 12 BTBD12 KIAA1784 KIAA1987 protein protein human Homo sapiens Human MKLSVNEAQLGFYLGSLSHLSACPGIDPRSSEDQPESLKTGQMMDESDEDFKELCASFFQRVKKHGIKEVSGERKTQKAASNGTQIRSKLKRTKQTATKTKTLQGPAEKKPPSGSQAPRTKKQRVTKWQASEPAHSVNGEGGVLASAPDPPVLRETAQNTQTGNQQEPSPNLSREKTRENVPNSDSQPPPSCLTTAVPSPSKPRTAQLVLQRMQQFKRADPERLRHASEECSLEAAREENVPKDPQEEMMAGNVYGLGPPAPESDAAVALTLQQEFARVGASAHDDSLEEKGLFFCQICQKNLSAMNVTRREQHVNRCLDEAEKTLRPSVPQIPECPICGKPFLTLKSRTSHLKQCAVKMEVGPQLLLQAVRLQTAQPEGSSSPPMFSFSDHSRGLKRRGPTSKKEPRKRRKVDEAPSEDLLVAMALSRSEMEPGAAVPALRLESAFSERIRPEAENKSRKKKPPVSPPLLLVQDSETTGRQIEDRVALLLSEEVELSSTPPLPASRILKEGWERAGQCPPPPERKQSFLWEGSALTGAWAMEDFYTARLVPPLVPQRPAQGLMQEPVPPLVPPEHSELSERRSPALHGTPTAGCGSRGPSPSASQREHQALQDLVDLAREGLSASPWPGSGGLAGSEGTAGLDVVPGGLPLTGFVVPSQDKHPDRGGRTLLSLGLLVADFGAMVNNPHLSDVQFQTDSGEVLYAHKFVLYARCPLLIQYVNNEGFSAVEDGVLTQRVLLGDVSTEAARTFLHYLYTADTGLPPGLSSELSSLAHRFGVSELVHLCEQVPIATDSEGKPWEEKEAENCESRAENFQELLRSMWADEEEEAETLLKSKDHEEDQENVNEAEMEEIYEFAATQRKLLQEERAAGAGEDADWLEGGSPVSGQLLAGVQVQKQWDKVEEMEPLEPGRDEAATTWEKMGQCALPPPQGQHSGARGAEAPEQEAPEEALGHSSCSSPSRDCQAERKEGSLPHSDDAGDYEQLFSSTQGEISEPSQITSEPEEQSGAVRERGLEVSHRLAPWQASPPHPCRFLLGPPQGGSPRGSHHTSGSSLSTPRSRGGTSQVGSPTLLSPAVPSKQKRDRSILTLSKEPGHQKGKERRSVLECRNKGVLMFPEKSPSIDLTQSNPDHSSSRSQKSSSKLNEEDEVILLLDSDEELELEQTKMKSISSDPLEEKKALEISPRSCELFSIIDVDADQEPSQSPPRSEAVLQQEDEGALPENRGSLGRRGAPWLFCDRESSPSEASTTDTSWLVPATPLASRSRDCSSQTQISSLRSGLAVQAVTQHTPRASVGNREGNEVAQKFSVIRPQTPPPQTPSSCLTPVSPGTSDGRRQGHRSPSRPHPGGHPHSSPLAPHPISGDRAHFSRRFLKHSPPGPSFLNQTPAGEVVEVGDSDDEQEVASHQANRSPPLDSDPPIPIDDCCWHMEPLSPIPIDHWNLERTGPLSTSSPSRRMNEAADSRDCRSPGLLDTTPIRGSCTTQRKLQEKSSGAGSLGNSRPSFLNSALWDVWDGEEQRPPETPPPAQMPSAGGAQKPEGLETPKGANRKKNLPPKVPITPMPQYSIMETPVLKKELDRFGVRPLPKRQMVLKLKEIFQYTHQTLDSDSEDESQSSQPLLQAPHCQTLASQTYKPSRAGVHAQQEATTGPGAHRPKGPAKTKGPRHQRKHHESITPPSRSPTKEAPPGLNDDAQIPASQESVATSVDGSDSSLSSQSSSSCEFGAAFESAGEEEGEGEVSASQAAVQAADTDEALRCYIRSKPALYQKVLLYQPFELRELQAELRQNGLRVSSRRLLDFLDTHCITFTTAATRREKLQGRRRQPRGKKKVERN slx1_human Structure-specific endonuclease subunit SLX1 GIYD1 GIYD2 SLX1 GIY-YIG domain-containing protein 1 SLX1A SLX1B protein protein human Homo sapiens Human MGPAGVAARPGRFFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGRGPWEMVLVVHGFPSSVAALRFEWAWQHPHASRRLAHVGPRLRGETAFAFHLRVLAHMLRAPPWARLPLTLRWVRPDLRQDLCLPPPPHVPLAFGPPPPQAPAPRRRAGPFDDAEPEPDQGDPGACCSLCAQTIQDEEGPLCCPHPGCLLRAHVICLAEEFLQEEPGQLLPLEGQCPCCEKSLLWGDLIWLCQMDTEKEVEDSELEEAHWTDLLET mus81_human Crossover junction endonuclease MUS81 MUS81 protein protein human Homo sapiens Human MAAPVRLGRKRPLPACPNPLFVRWLTEWRDEATRSRRRTRFVFQKALRSLRRYPLPLRSGKEAKILQHFGDGLCRMLDERLQRHRTSGGDHAPDSPSGENSPAPQGRLAEVQDSSMPVPAQPKAGGSGSYWPARHSGARVILLVLYREHLNPNGHHFLTKEELLQRCAQKSPRVAPGSARPWPALRSLLHRNLVLRTHQPARYSLTPEGLELAQKLAESEGLSLLNVGIGPKEPPGEETAVPGAASAELASEAGVQQQPLELRPGEYRVLLCVDIGETRGGGHRPELLRELQRLHVTHTVRKLHVGDFVWVAQETNPRDPANPGELVLDHIVERKRLDDLCSSIIDGRFREQKFRLKRCGLERRVYLVEEHGSVHNLSLPESTLLQAVTNTQVIDGFFVKRTADIKESAAYLALLTRGLQRLYQGHTLRSRPWGTPGNPESGAMTSPNPLCSLLTFSDFNAGAIKNKAQSVREVFARQLMQVRGVSGEKAAALVDRYSTPASLLAAYDACATPKEQETLLSTIKCGRLQRNLGPALSRTLSQLYCSYGPLT ercc1_human DNA excision repair protein ERCC-1 ERCC1 protein protein human Homo sapiens Human MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP terf2_human Telomeric repeat-binding factor 2 TTAGGG repeat-binding factor 2 Telomeric DNA-binding protein TERF2 TRF2 TRBF2 protein protein human Homo sapiens Human MAAGAGTAGPASGPGVVRDPAASQPRKRPGREGGEGARRSDTMAGGGGSSDGSGRAAGRRASRSSGRARRGRHEPGLGGPAERGAGEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPLGKEHTVSRLLRVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIKTEFTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRNDLLNIIREKNLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTMAKKALKSESAASSTGKEDKQPAPGPVEKPPREPARQLRNPPTTIGMMTLKAAFKTLSGAQDSEAAFAKLDQKDLVLPTQALPASPALKNKRPRKDENESSAPADGEGGSELQPKNKRMTISRLVLEEDSQSTEPSAGLNSSQEAASAPPSKPTVLNQPLPGEKNPKVPKGKWNSSNGVEEKETWVEEDELFQVQAAPDEDSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKRLGMN q7ytz1_drome mus312 mus312-RD Dmel_CG8601 Dmel\CG8601 MUS312 mus(3)312 CG8601 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDRKTRRANFKNLQPRLTRSTKAAADTLSLSNFFATPENAEEVPSCLADIPVQPDPPAPKIKPIRTSNVFEKPGPKPKKAPKLKASTVSTSSGARRGRGKSKQQPSISNFLRNEQIFAEVTAQHCMADNFSADDIEMALALSKSESEKHGRLRLHDDDDAVVDLLDDEEKSTERIRHKLQKYGFRTAAKEDYKSLAVLPVVASKGGRRGKWANRFTSLTLRNPDVQQKKLEEKVSALLGQEMRGKEPNGEDCCLTPYTVITAALKELRAEGESRILREPSEGPIDDLESYYVTDLFEVSRTPAHHLLKNWAAIQGRDFSPERETQKCRQLRQQHELVYAELERYYGDPQKLEEEVMQELDELEKLVADNMIEDDSVVINIVEAESSSTGSSPSKEPPDKRPKMTMEDKENLQPTTSKASLTVPAQSTRCTSPDLFADSEDEPDIVTTAISNEPEDVRNLSMKVYKNVSISERSSSVAEIEIVSSNDEPSQITTYEVFSSDEDCFQRYAGEDFF slx1_drome Structure-specific endonuclease subunit SLX1 homolog CG18271 slx1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNSYDPQDTASQQEESVALKGHFYGVYLLCSQSLDPRYRGKCYVGFTVNPKRRIRQHNLGCDFGGARKTSRKGPWLMVMIVHGFPNNTVALQFEWAWQQPSLSTRLKMYPELKRKLPRETFFDYNFRILSNMLGVGPWNRLPLTVRWLETDYERPFSKALPKHMEIVSGKVSISASQRRRPDDAVPPPPVAWASECHLCMQEMEQPEKSRLGCTNQMCRLTCHMVCLANYLLGDEPGHYIPVGGECPLCETRLSWAALLQRKRLLLGVPEELQDHDEDLSDDIDVDSDIEDTPELSD eme1_human Crossover junction endonuclease EME1 EME1 MMS4 MMS4 homolog protein protein human Homo sapiens Human MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDISDCEASCPPAPELFSPPVPEIAETVTQTQPVRLLSSESEDEEEFIPLAQRLTCKFLTHKQLSPEDSSSPVKSVLDHQNNEGASCDWKKPFPKIPEVPLHDTPERSAADNKDLILDPCCQLPAYLSTCPGQSSSLAVTKTNSDILPPQKKTKPSQKVQGRGSHGCRQQRQARQKESTLRRQERKNAALVTRMKAQRPEECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRRAGPSEDREDWVEEPTVLVLLRAEAFVSMIDNGKQGSLDSTMKGKETLQGFVTDITAKTAGKALSLVIVDQEKCFSAQNPPRRGKQGANKQTKKQQQRQPEASIGSMVSRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPFKKLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRRIYLQMTTLQPHLSLDSAD btbd12-giyd1-3 Interaction between BTBD12 (SLX4), ERCC4 and GIYD1/2 (SLX1) by coimmunoprecipitation 837255 n/a 837260 unspecified role unspecified role prey prey n/a 837261 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 837262 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2C, Supp. Fig. 4 giyd1-mus81-1 Interaction between GIYD1/2, BTBD12 and MUS81 determined by coimmunoprecipitation 837255 n/a 837263 unspecified role unspecified role prey prey n/a 837261 unspecified role unspecified role ancillary ancillary region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 837262 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 6B btbd12-ercc1-2 Interaction between BTBD12 (SLX4), ERCC1 and ERCC4 by coimmunoprecipitation 837255 n/a 837260 unspecified role unspecified role prey prey n/a 837261 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 837264 unspecified role unspecified role prey prey association association false false false Supp. Figs. 3 and 16 btbd12-terf2-4 Interaction between BTBD12 (SLX4) and TERF2 by coimmunoprecipitation 837255 n/a 837265 unspecified role unspecified role prey prey n/a 837261 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Supp. Figs. 3 and 16 btbd12-ercc1-4 Interaction between BTBD12 (SLX4), TERF2 ERCC1 and ERCC4 by coimmunoprecipitation 837255 n/a 837264 unspecified role unspecified role prey prey n/a 837260 unspecified role unspecified role prey prey n/a 837261 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 837265 unspecified role unspecified role prey prey association association false false false Supp. Figs. 3 and 16 mus312-slk1-1 Interaction between slk1 and mus32 identified by Y2H 837256 n/a 837266 unspecified role unspecified role prey prey n/a 837267 unspecified role unspecified role bait bait physical association physical association false false false Fig. 1B btbd12-giyd1-1 Interaction between BTBD12 (SLX4) and GIYD1/2 (SLX1) by Y2H 837256 n/a 837261 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 837262 unspecified role unspecified role bait bait physical association physical association false false false Figs. 2A, 2B btbd12-ercc4-3 Interaction between BTBD12 (SLX4) and ERCC4 (XPD) by Y2H 837256 n/a 837261 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 837260 unspecified role unspecified role bait bait physical association physical association false false false Figs. 2D, 2E btbd12-giyd1-2 Interaction between BTBD12 (SLX4) and GIYD1/2 (SLX1) by coimmunoprecipitation 837257 n/a 837262 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 837261 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2C btbd12-mus81-2 Interaction between BTBD12 and MUS81 determined by coimmunoprecipitation 837257 n/a 837261 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 837263 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 6C eme1-btbd12-1 Interaction between BTBD12 and EME1 identified by coimmunoprecipitation 837257 n/a 837268 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 837261 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6D eme1-mus81-1 Interactors of EME1 837258 n/a 837263 unspecified role unspecified role prey prey n/a 837261 unspecified role unspecified role prey prey n/a 837268 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 6A btbd12-giyd1-4 Colocalisation of BTBD12 (SLX4) and GIYD1/2 (SLX1) 837259 n/a 837261 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 837262 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Supp. Fig. 2