MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint regni-2009-2 How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic. in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Regni CA., Roush RF., Miller DJ., Nourse A., Walsh CT., Schulman BA. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation regni-2009-1 How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Regni CA., Roush RF., Miller DJ., Nourse A., Walsh CT., Schulman BA. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation q47506_ecolx mccB protein protein ecolx Escherichia coli MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKVVADLYGSEKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGNRM mint mccc7_ecolx Microcin C7 mccA Microcin C51 protein protein ecolx Escherichia coli MRTGNAN mint mcca-mccb-1 856809 q47506_ecolx MccB 856811 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Q47506:p.Cys123Leu mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.1 mccc7_ecolx MccA 856812 peptide synthesis peptide synthesis enzyme target enzyme target substrate substrate neutral component neutral component purified purified Stoichiometry: 1.2 enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false mint t2 f5b f5c f5d f7b mcca-mccb-2 856809 q47506_ecolx MccB 856811 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Q47506:p.Tyr239Ala mutation increasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false mccc7_ecolx MccA 856812 peptide synthesis peptide synthesis enzyme target enzyme target substrate substrate neutral component neutral component purified purified enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false mint t2 f5b f5c f5d f7b mcca-mccb-3 856809 q47506_ecolx MccB 856811 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Q47506:p.Lys10Ala mutation increasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false mccc7_ecolx MccA 856812 peptide synthesis peptide synthesis enzyme target enzyme target substrate substrate neutral component neutral component purified purified enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false mint t2 f5b f5c f5d f7b mcca-mccb-4 856809 mccc7_ecolx MccA 856812 peptide synthesis peptide synthesis enzyme target enzyme target substrate substrate neutral component neutral component purified purified q47506_ecolx MccB 856811 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Q47506:p.Asp214Ala mutation increasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false mint t2 f5b f5c f5d f7b mcca-mccb-5 856809 q47506_ecolx MccB 856811 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Q47506:p.Asn241Ala mutation increasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false mccc7_ecolx MccA 856812 peptide synthesis peptide synthesis enzyme target enzyme target substrate substrate neutral component neutral component purified purified enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false mint t2 f5b f5c f5d f7b mcca-mccb-6 856809 q47506_ecolx MccB 856811 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Q47506:p.Arg94Ala mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false mccc7_ecolx MccA 856812 peptide synthesis peptide synthesis enzyme target enzyme target substrate substrate neutral component neutral component purified purified enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false mint t2 f5b f5c f5d f7b mcca-mccb-7 856809 mccc7_ecolx MccA 856812 peptide synthesis peptide synthesis enzyme target enzyme target substrate substrate neutral component neutral component purified purified q47506_ecolx MccB 856811 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Q47506:p.His215Ala mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false mint t2 f5b f5c f5d f7b mccb-1 856810 q47506_ecolx MccB 856811 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false mint t1 mcca-mccb 856810 q47506_ecolx MccB 856811 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.1 mccc7_ecolx MccA 856812 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.2 direct interaction direct interaction false false false mint f2 f3a f4 t1