MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint gaitanos-2009-1 Stable kinetochore-microtubule interactions depend on the Ska complex and its new component Ska3/C13Orf3. human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Gaitanos TN., Santamaria A., Jeyaprakash AA., Wang B., Conti E., Nigg EA. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation gaitanos-2009-2 Stable kinetochore-microtubule interactions depend on the Ska complex and its new component Ska3/C13Orf3. human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Gaitanos TN., Santamaria A., Jeyaprakash AA., Wang B., Conti E., Nigg EA. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation gaitanos-2009-3 Stable kinetochore-microtubule interactions depend on the Ska complex and its new component Ska3/C13Orf3. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Gaitanos TN., Santamaria A., Jeyaprakash AA., Wang B., Conti E., Nigg EA. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation gaitanos-2009-4 Stable kinetochore-microtubule interactions depend on the Ska complex and its new component Ska3/C13Orf3. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gaitanos TN., Santamaria A., Jeyaprakash AA., Wang B., Conti E., Nigg EA. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation gaitanos-2009-5 Stable kinetochore-microtubule interactions depend on the Ska complex and its new component Ska3/C13Orf3. human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Gaitanos TN., Santamaria A., Jeyaprakash AA., Wang B., Conti E., Nigg EA. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation ska2_human Spindle and kinetochore-associated protein 2 SKA2 FAM33A Protein FAM33A protein protein human Homo sapiens Human MEAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKSRYQTLYARFKPVAVEQKESKSRICATVKKTMNMIQKLQKQTDLELSPLTKEEKTAAEQFKFHMPDL ska1_human Spindle and kinetochore-associated protein 1 SKA1 C18orf24 protein protein human Homo sapiens Human MASSDLEQLCSHVNEKIGNIKKTLSLRNCGQEPTLKTVLNKIGDEIIVINELLNKLELEIQYQEQTNNSLKELCESLEEDYKDIEHLKENVPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEMPFITCDEFNGVPSYMKSRLTYNQINDVIKEINKAVISKYKILHQPKKSMNSVTRNLYHRFIDEETKDTKGRYFIVEADIKEFTTLKADKKFHVLLNILRHCRRLSEVRGGGLTRYVIT ska3_human Spindle and kinetochore-associated protein 3 SKA3 C13orf3 RAMA1 protein protein human Homo sapiens Human MDPIRSFCGKLRSLASTLDCETARLQRALDGEESDFEDYPMRILYDLHSEVQTLKDDVNILLDKARLENQEGIDFIKATKVLMEKNSMDIMKIREYFQKYGYSPRVKKNSVHEQEAINSDPELSNCENFQKTDVKDDLSDPPVASSCISEKSPRSPQLSDFGLERYIVSQVLPNPPQAVNNYKEEPVIVTPPTKQSLVKVLKTPKCALKMDDFECVTPKLEHFGISEYTMCLNEDYTMGLKNARNNKSEEAIDTESRLNDNVFATPSPIIQQLEKSDAEYTNSPLVPTFCTPGLKIPSTKNSIALVSTNYPLSKTNSSSNDLEVEDRTSLVLNSDTCFENLTDPSSPTISSYENLLRTPTPPEVTKIPEDILQLLSKYNSNLATPIAIKAVPPSKRFLKHGQNIRDVSNKEN ska2-ska1 857163 ska2_human Ska2 857168 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ska1_human Ska1 857169 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ska3_human Ska3 857170 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false F1A homomint mint ska3-ska1 857164 ska2_human Ska2 857168 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ska1_human Ska1 857169 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ska3_human Ska3 857170 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false F1B homomint mint ska1-ska2 857165 ska3_human Ska3 857170 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ska2_human Ska2 857168 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ska1_human Ska1 857169 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association false false false F2A homomint mint ska2-ska1-1 857166 ska1_human Ska1 857169 weight identificat confirmation by molecular weight weight identificat unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ska2_human Ska2 857168 weight identificat confirmation by molecular weight weight identificat unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ska3_human Ska3 857170 weight identificat confirmation by molecular weight weight identificat unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false F2D homomint mint ska1-ska3 857167 ska1_human Ska1 857169 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell ska3_human Ska3 857170 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false F1C homomint mint