IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ chini-2009-1 The ZIM domain mediates homo- and heteromeric interactions between Arabidopsis JAZ proteins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chini A., Fonseca S., Chico JM., Fernandez-Calvo P., Solano R. rsolano@cnb.csic.es Plant J. (0960-7412) 2009 Only protein-protein interactions imex curation chini-2009-2 The ZIM domain mediates homo- and heteromeric interactions between Arabidopsis JAZ proteins. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Chini A., Fonseca S., Chico JM., Fernandez-Calvo P., Solano R. rsolano@cnb.csic.es Plant J. (0960-7412) 2009 Only protein-protein interactions imex curation chini-2009-4 The ZIM domain mediates homo- and heteromeric interactions between Arabidopsis JAZ proteins. nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chini A., Fonseca S., Chico JM., Fernandez-Calvo P., Solano R. rsolano@cnb.csic.es Plant J. (0960-7412) 2009 Only protein-protein interactions imex curation chini-2009-3 The ZIM domain mediates homo- and heteromeric interactions between Arabidopsis JAZ proteins. nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Chini A., Fonseca S., Chico JM., Fernandez-Calvo P., Solano R. rsolano@cnb.csic.es Plant J. (0960-7412) 2009 Only protein-protein interactions imex curation tif6b_arath Protein TIFY 6B TIFY6B JAI3 JAZ3 MEB5.8 At3g17860 Jasmonate ZIM domain-containing protein 3 Protein JASMONATE INSENSITIVE 3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDFLGLGSKNSPITVKEETSESSRDSAPNRGMNWSFSNKVSASSSQFLSFRPTQEDRHRKSGNYHLPHSGSFMPSSVADVYDSTRKAPYSSVQGVRMFPNSNQHEETNAVSMSMPGFQSHHYAPGGRSFMNNNNNSQPLVGVPIMAPPISILPPPGSIVGTTDIRSSSKPIGSPAQLTIFYAGSVCVYDDISPEKAKAIMLLAGNGSSMPQVFSPPQTHQQVVHHTRASVDSSAMPPSFMPTISYLSPEAGSSTNGLGATKATRGLTSTYHNNQANGSNINCPVPVSCSTNVMAPTVALPLARKASLARFLEKRKERVTSVSPYCLDKKSSTDCRRSMSECISSSLSSAT coi1_arath Coronatine-insensitive protein 1 FBL2 At2g39940 COI1 COI-1 F-box/LRR-repeat protein 2 T28M21.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEDPDIKRCKLSCVATVDDVIEQVMTYITDPKDRDSASLVCRRWFKIDSETREHVTMALCYTATPDRLSRRFPNLRSLKLKGKPRAAMFNLIPENWGGYVTPWVTEISNNLRQLKSVHFRRMIVSDLDLDRLAKARADDLETLKLDKCSGFTTDGLLSIVTHCRKIKTLLMEESSFSEKDGKWLHELAQHNTSLEVLNFYMTEFAKISPKDLETIARNCRSLVSVKVGDFEILELVGFFKAAANLEEFCGGSLNEDIGMPEKYMNLVFPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLETRNVIGDRGLEVLAQYCKQLKRLRIERGADEQGMEDEEGLVSQRGLIALAQGCQELEYMAVYVSDITNESLESIGTYLKNLCDFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFYLRQGGLTDLGLSYIGQYSPNVRWMLLGYVGESDEGLMEFSRGCPNLQKLEMRGCCFSERAIAAAVTKLPSLRYLWVQGYRASMTGQDLMQMARPYWNIELIPSRRVPEVNQQGEIREMEHPAHILAYYSLAGQRTDCPTTVRVLKEPI myc2_arath Transcription factor MYC2 MYC2 BHLH6 Basic helix-loop-helix protein 6 EN38 JAI1 JIN1 Protein JASMONATE INSENSITIVE 1 R-homologous Arabidopsis protein 1 RAP1 RD22BP1 Transcription factor EN 38 Z-box binding factor 1 protein ZBF1 bHLH transcription factor bHLH006 rd22BP1 F6N18.4 At1g32640 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTDYRLQPTMNLWTTDDNASMMEAFMSSSDISTLWPPASTTTTTATTETTPTPAMEIPAQAGFNQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKANPRRRSSSPPFSTPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACGAGLAGKAFATGNAVWVSGSDQLSGSGCERAKQGGVFGMHTIACIPSANGVVEVGSTEPIRQSSDLINKVRILFNFDGGAGDLSGLNWNLDPDQGENDPSMWINDPIGTPGSNEPGNGAPSSSSQLFSKSIQFENGSSSTITENPNLDPTPSPVHSQTQNPKFNNTFSRELNFSTSSSTLVKPRSGEILNFGDEGKRSSGNPDPSSYSGQTQFENKRKRSMVLNEDKVLSFGDKTAGESDHSDLEASVVKEVAVEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEEVKLELAGRKASASGGDMSSSCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHASMSVVNDLMIQQATVKMGFRIYTQEQLRASLISKIG ti10a_arath Protein TIFY 10A TIFY10A JAZ1 At1g19180 T29M8.5 Jasmonate ZIM domain-containing protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSSMECSEFVGSRRFTGKKPSFSQTCSRLSQYLKENGSFGDLSLGMACKPDVNGTLGNSRQPTTTMSLFPCEASNMDSMVQDVKPTNLFPRQPSFSSSSSSLPKEDVLKMTQTTRSVKPESQTAPLTIFYAGQVIVFNDFSAEKAKEVINLASKGTANSLAKNQTDIRSNIATIANQVPHPRKTTTQEPIQSSPTPLTELPIARRASLHRFLEKRKDRVTSKAPYQLCDPAKASSNPQTTGNMSWLGLAAEI ti10b_arath Protein TIFY 10B TIFY10B JAZ2 F9E10.20 F25A4.8 At1g74950 Jasmonate ZIM domain-containing protein 2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSFSAECWDFSGRKPSFSQTCTRLSRYLKEKGSFGDLSLGMTCKPDVNGGSRQPTMMNLFPCEASGMDSSAGQEDIKPKTMFPRQSSFSSSSSSGTKEDVQMIKETTKSVKPESQSAPLTIFYGGRVMVFDDFSAEKAKEVIDLANKGSAKSFTCFTAEVNNNHSAYSQKEIASSPNPVCSPAKTAAQEPIQPNPASLACELPIARRASLHRFLEKRKDRITSKAPYQIDGSAEASSKPTNPAWLSSR ti11a_arath Protein TIFY 11A TIFY11A JAZ5 Jasmonate ZIM domain-containing protein 5 F1L3.3 F28G4.16 At1g17380 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSSNENAKAQAPEKSDFTRRCSLLSRYLKEKGSFGNIDLGLYRKPDSSLALPGKFDPPGKQNAMHKAGHSKGEPSTSSGGKVKDVADLSESQPGSSQLTIFFGGKVLVYNEFPVDKAKEIMEVAKQAKPVTEINIQTPINDENNNNKSSMVLPDLNEPTDNNHLTKEQQQQQEQNQIVERIARRASLHRFFAKRKDRAVARAPYQVNQNAGHHRYPPKPEIVTGQPLEAGQSSQRPPDNAIGQTMAHIKSDGDKDDIMKIEEGQSSKDLDLRL tif5a_arath Protein TIFY 5A TIFY5A JAZ8 Jasmonate ZIM domain-containing protein 8 T2H7 At1g30135 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKLQQNCDLELRLFPTSYDSDSSDTTSVVESTSSGNPQPNEESQRITIFYNGKMCFSSDVTHLQARSIISIASREMKTKSSSNGSDPPNKSTSFHHNQLPNPKASMKKSLQSFLQKRKIRIQATSPYHSRR tif7_arath Protein TIFY 7 TIFY7 JAZ9 F5A18.12 At1g70700 Jasmonate ZIM domain-containing protein 9 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDFLGLSDKQYLSNNVKHEVNDDAVEERGLSTKAAREWGKSKVFATSSFMPSSDFQEAKAFPGAYQWGSVSAANVFRRCQFGGAFQNATPLLLGGSVPLPTHPSLVPRVASSGSSPQLTIFYGGTISVFNDISPDKAQAIMLCAGNGLKGETGDSKPVREAERMYGKQIHNTAATSSSSATHTDNFSRCRDTPVAATNAMSMIESFNAAPRNMIPSVPQARKASLARFLEKRKERLMSAMPYKKMLLDLSTGESSGMNYSSTSPT tif9_arath Protein TIFY 9 TIFY9 JAS1 JAZ10 Protein JASMONATE-ASSOCIATED 1 Jasmonate ZIM domain-containing protein 10 Protein JAZ10 T31B5.40 At5g13220 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSKATIELDFLGLEKKQTNNAPKPKFQKFLDRRRSFRDIQGAISKIDPEIIKSLLASTGNNSDSSAKSRSVPSTPREDQPQIPISPVHASLARSSTELVSGTVPMTIFYNGSVSVFQVSRNKAGEIMKVANEAASKKDESSMETDLSVILPTTLRPKLFGQNLEGDLPIARRKSLQRFLEKRKERLVSTSPYYPTSA tif3b_arath Protein TIFY 3B TIFY3B JAZ12 Jasmonate ZIM domain-containing protein 12 F22D1.70 At5g20900 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTKVKDEPRASVEGGCGVADGDGGAAEIGGTGSVEKSINEVRSTEIQTAEPTVPPNQLTIFFGGSVTVFDGLPSEKVQEILRIAAKAMETKNSTSISPVSSPALNRAPSFSSTSNVASPAAQPFPIQPISFCRSTADLPIARRHSLQRFLEKRRDRLVNKNPYPTSDFKKTDVPTGNVSIKEEFPTA ti11b_arath Protein TIFY 11B TIFY11B JAZ6 Jasmonate ZIM domain-containing protein 6 T10D10.8 At1g72450 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTGQAPEKSNFSQRCSLLSRYLKEKGSFGNINMGLARKSDLELAGKFDLKGQQNVIKKVETSETRPFKLIQKFSIGEASTSTEDKAIYIDLSEPAKVAPESGNSQLTIFFGGKVMVFNEFPEDKAKEIMEVAKEANHVAVDSKNSQSHMNLDKSNVVIPDLNEPTSSGNNEDQETGQQHQVVERIARRASLHRFFAKRKDRAVARAPYQVNQHGSHLPPKPEMVAPSIKSGQSSQHIATPPKPKAHNHMPMEVDKKEGQSSKNLELKL tif6a_arath Protein TIFY 6A TIFY6A JAZ4 Jasmonate ZIM domain-containing protein 4 T1N15.11 At1g48500 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDFLGLGSKLSPITVKEETNEDSAPSRGMMDWSFSSKVGSGPQFLSFGTSQQETRVNTVNDHLLSSAAMDQNQRTYFSSLQEDRVFPGSSQQDQTTITVSMSEPNYINSFINHQHLGGSPIMAPPVSVFPAPTTIRSSSKPLPPQLTIFYAGSVLVYQDIAPEKAQAIMLLAGNGPHAKPVSQPKPQKLVHHSLPTTDPPTMPPSFLPSISYIVSETRSSGSNGVTGLGPTKTKASLASTRNNQTAAFSMAPTVGLPQTRKASLARFLEKRKERVINVSPYYVDNKSSIDCRTLMSECVSCPPAHHLH tif3a_arath Protein TIFY 3A TIFY3A JAZ11 Jasmonate ZIM domain-containing protein 11 T18D12.10 At3g43440 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAEVNGDFPVPSFADGTGSVSAGLDLLVERSIHEARSTEPDASTQLTIIFGGSCRVFNGVPAQKVQEIIRIAFAGKQTKNVTGINPALNRALSFSTVADLPIARRRSLQRFLEKRRDRSTKPDGSMILPSQLTIIFGGSFSVFDGIPAEKVQEILHIAAAAKATETINLTSINPALKRAISFSNASTVACVSTADVPIARRRSLQRFFEKRRHRFVHTKPYSATTSEADKNETSPIVT col1-tify6b-3 COL1 interacts with JAZ3 805408 n/a 805412 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 805413 unspecified role unspecified role prey prey physical association physical association false false false Figure 1b 50 micro molar coronatine tify6b-myc2-1 JAZ3 interacts with MYC2 805408 n/a 805412 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 805414 unspecified role unspecified role prey prey physical association physical association false false false Figure 2d tify10a-myc2-2 JAZ1 interacts with MYC2 805408 n/a 805415 unspecified role unspecified role bait bait n/a 805414 unspecified role unspecified role prey prey physical association physical association false false false Figure 3b Figure 3c tify10b-myc2-1 JAZ2 interacts with MYC2 805408 n/a 805416 unspecified role unspecified role bait bait n/a 805414 unspecified role unspecified role prey prey physical association physical association false false false Figure 3b Figure 3c tify11a-myc2-3 JAZ5 interacts with MYC2 805408 n/a 805417 unspecified role unspecified role bait bait n/a 805414 unspecified role unspecified role prey prey physical association physical association false false false Figure 3b Figure 3c tify5a-myc2-5 JAZ8 interacts with MYC2 805408 n/a 805418 unspecified role unspecified role bait bait n/a 805414 unspecified role unspecified role prey prey physical association physical association false false false Figure 3b Figure 3c tify7-myc2-2 JAZ9 interacts with MYC2 805408 n/a 805419 unspecified role unspecified role bait bait n/a 805414 unspecified role unspecified role prey prey physical association physical association false false false Figure 3b Figure 3c tify9-myc2-1 JAZ10 interacts with MYC2 805408 n/a 805420 unspecified role unspecified role bait bait n/a 805414 unspecified role unspecified role prey prey physical association physical association false false false Figure 3b Figure 3c tify3b-myc2-1 JAZ12 interacts with MYC2 805408 n/a 805421 unspecified role unspecified role bait bait n/a 805414 unspecified role unspecified role prey prey physical association physical association false false false Figure 3b Figure 3c tify11b-myc2-4 JAZ6 interacts with MYC2 805408 n/a 805422 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) n/a 805414 unspecified role unspecified role prey prey physical association physical association false false false Figure 3c tify10a-1 JAZ1 homodimer 805408 n/a 805415 unspecified role unspecified role bait bait n/a 805415 unspecified role unspecified role prey prey physical association physical association false false false Figure 5 Figure 6 tify6b-2 JAZ3 homodimer 805408 n/a 805412 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 805412 unspecified role unspecified role prey prey physical association physical association false false false Figure 4d Figure 5a tify6a-2 JAZ4 homodimer 805408 n/a 805423 unspecified role unspecified role bait bait n/a 805423 unspecified role unspecified role prey prey physical association physical association false false false Figure 5a tify7-3 JAZ9 homodimer 805408 n/a 805419 unspecified role unspecified role prey prey n/a 805419 unspecified role unspecified role bait bait physical association physical association false false false Figure 5a Figure 6 tify10a-tify6a JAZ1 interacts with JAZ4 805408 n/a 805423 unspecified role unspecified role prey prey n/a 805415 unspecified role unspecified role bait bait physical association physical association false false false Figure 6 tify10a-tify5a JAZ1 interacts with JAZ8 805408 n/a 805415 unspecified role unspecified role bait bait n/a 805418 unspecified role unspecified role prey prey physical association physical association false false false Figure 6 tify10a-tify7 JAZ1 interacts with JAZ9 805408 n/a 805415 unspecified role unspecified role bait bait n/a 805419 unspecified role unspecified role prey prey physical association physical association false false false Figure 6 tify6a-tify6b JAZ4 interacts with JAZ3 805408 n/a 805423 unspecified role unspecified role bait bait n/a 805412 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 6 Figure 7 tify6b-tify6a JAZ3 interacts with JAZ4 805408 n/a 805412 unspecified role unspecified role bait bait n/a 805423 unspecified role unspecified role prey prey physical association physical association false false false Figure 6 tify6b-tify7 JAZ3 interacts with JAZ9 805408 n/a 805412 unspecified role unspecified role bait bait n/a 805419 unspecified role unspecified role prey prey physical association physical association false false false Figure 6 tify6a-tify7 JAZ4 interacts with JAZ9 805408 n/a 805419 unspecified role unspecified role prey prey n/a 805423 unspecified role unspecified role bait bait physical association physical association false false false Figure 6 tiry5a-tify10a-1 JAZ8 interacts with JAZ1 805408 n/a 805415 unspecified role unspecified role prey prey n/a 805418 unspecified role unspecified role bait bait physical association physical association false false false Figure 6 tify7-tify6b JAZ9 interacts with JAZ3 805408 n/a 805412 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 805419 unspecified role unspecified role bait bait physical association physical association false false false Figure 6 Figure 7a tify7-tify6a JAZ9 interacts with JAZ4 805408 n/a 805423 unspecified role unspecified role prey prey n/a 805419 unspecified role unspecified role bait bait physical association physical association false false false Figure 6 tify10a-tify6b JAZ1 interacts with JAZ3 805408 n/a 805415 unspecified role unspecified role bait bait n/a 805412 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 7a col1-tify6b-2 COL1 interacts with JAZ3 805409 n/a 805412 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 805413 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false Figure 1a 50 micro molar coronatine tify6b-myc2 JAZ3 interacts with MYC2 805409 n/a 805412 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 805414 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 2c tify10a-myc2-1 JAZ1 interacts with MYC2 805409 n/a 805415 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 805414 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 3a The authors concluded that the interaction was strong in the case of JAZ1. tify10b-myc2 JAZ2 interacts with MYC2 805409 n/a 805416 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 805414 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 3a The authors concluded that the interaction was strong in the case of JAZ2. tify6a-myc2-1 JAZ4 interacts with MYC2 805409 n/a 805423 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 805414 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 3a The authors concluded that the interaction was weak in the case of JAZ4. tify11a-myc2-2 JAZ5 interacts with MYC2 805409 n/a 805417 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 805414 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 3a The authors concluded that the interaction was strong in the case of JAZ5. tify11b-myc2-3 JAZ6 interacts with MYC2 805409 n/a 805422 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 805414 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 3a The authors concluded that the interaction was weak in the case of JAZ6. tify5a-myc2-4 JAZ 8 interacts with MYC2 805409 n/a 805418 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 805414 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 3a The authors concluded that the interaction was weak in the case of JAZ8. tify7-myc2-1 JAZ9 interacts with MYC2 805409 n/a 805419 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 805414 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 3a The authors concluded that the interaction was strong in the case of JAZ9. tify9-myc2 JAZ10 interacts with MYC2 805409 n/a 805420 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 805414 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 3a The authors concluded that the interaction was strong in the case of JAZ10. tify3a-myc2 JAZ11 interacts with MYC2 805409 n/a 805424 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 805414 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 3a The authors concluded that the interaction was strong in the case of JAZ11. tify3b-myc2 JAZ12 interacts with MYC2 805409 n/a 805421 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 805414 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 3a The authors concluded that the interaction was weak in the case of JAZ12. tify3a-myc2-1 JAZ11 interacts with MYC2 805409 n/a 805424 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 805414 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 3a The authors concluded that the interaction was strong in the case of JAZ11. tify6b-3 JAZ3 homodimer 805409 n/a 805412 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress n/a 805412 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 4c tify6b-1 JAZ3 homodimer 805409 n/a 805412 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 805412 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false Figure 7b The authors concluded the bait and prey interaction was 'strong'. tify6a-tify10a JAZ1 interacts with JAZ3 805409 n/a 805415 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 805412 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false Figure 7b The authors concluded the bait and prey interaction was 'strong'. tify6a-tify6b-1 JAZ4 interacts with JAZ3 805409 n/a 805423 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 805412 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false Figure 7b The authors concluded the bait and prey interaction was 'strong'. tify6a-tify10b JAZ2 interacts with JAZ3 805409 n/a 805416 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 805412 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false Figure 7b The authors concluded the bait and prey interaction was 'weak'. tify6a-tify11a JAZ5 interacts with JAZ3 805409 n/a 805417 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 805412 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false Figure 7b The authors concluded the bait and prey interaction was 'weak'. tify6a-tify11b JAZ6 interacts with JAZ3 805409 n/a 805412 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress n/a 805422 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 7b The authors concluded the bait and prey interaction was 'weak'. tify6a-tify9 JAZ10 interacts with JAZ3 805409 n/a 805412 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress n/a 805420 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 7b The authors concluded the bait and prey interaction was 'weak'. tify6b-5 JAZ3 homodimer 805410 n/a 805412 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false nicbe Nicotiana benthamiana n/a 805412 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 8b tify6b-tify7-1 JAZ3 interacts with JAZ9 805410 n/a 805412 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 805419 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nicbe Nicotiana benthamiana physical association physical association false false false Figure 8b tify6b-4 JAZ3 homodimer 805411 n/a 805412 unspecified role unspecified role neutral component neutral component region N-terminal YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 805412 unspecified role unspecified role neutral component neutral component n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region C-terminal YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Figure 8