IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lievens-2009-2 Array MAPPIT: high-throughput interactome analysis in mammalian cells. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. mappit mammalian protein protein interaction trap mappit predetermined predetermined participant predetermined Lievens S., Vanderroost N., Van der Heyden J., Gesellchen V., Vidal M., Tavernier J. An array MAPPIT screening was carried out. A collection of prey plasmids together with a reporter plasmid is mixed with a transfection reagent and spotted in microtiter plates to generate prey arrays. Sets of these are reverse transfected by overlaying them with a bait-expressing cell line and treated with ligand or left unstimulated before read-out of the luciferase activity. The gene identifiers provided in the supplementary materials were used to map the proteins, where this was not possible the gene names were used. The cDNA and interactions discussed in the publication indicate that all the proteins were from human origin hence human proteins used for interactions. Some of the identifiers provided, however, indicate mouse origin e.g. 55336 FBXL8 F-box and leucine-rich repeat protein 8". This is a mouse protein (immunoglobulin light chain). jan.tavernier@ugent.be HEK293T-derived MAPPIT prey cDNA library (hORFeome v3.1 collection). Nat. Cell Biol. (1465-7392) 2009 Only protein-protein interactions imex curation lievens-2009-1 Array MAPPIT: high-throughput interactome analysis in mammalian cells. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. mappit mammalian protein protein interaction trap mappit nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lievens S., Vanderroost N., Van der Heyden J., Gesellchen V., Vidal M., Tavernier J. An array MAPPIT screening was carried out. A collection of prey plasmids together with a reporter plasmid is mixed with a transfection reagent and spotted in microtiter plates to generate prey arrays. Sets of these are reverse transfected by overlaying them with a bait-expressing cell line and treated with ligand or left unstimulated before read-out of the luciferase activity. The gene identifiers provided in the supplementary materials were used to map the proteins, where this was not possible the gene names were used. The cDNA and interactions discussed in the publication indicate that all the proteins were from human origin hence human proteins used for interactions. Some of the identifiers provided, however, indicate mouse origin e.g. 55336 FBXL8 F-box and leucine-rich repeat protein 8". This is a mouse protein (immunoglobulin light chain). jan.tavernier@ugent.be HEK293T-derived MAPPIT prey cDNA library (hORFeome v3.1 collection). Nat. Cell Biol. (1465-7392) 2009 Only protein-protein interactions imex curation lievens-2009-3 Array MAPPIT: high-throughput interactome analysis in mammalian cells. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lievens S., Vanderroost N., Van der Heyden J., Gesellchen V., Vidal M., Tavernier J. An array MAPPIT screening was carried out. A collection of prey plasmids together with a reporter plasmid is mixed with a transfection reagent and spotted in microtiter plates to generate prey arrays. Sets of these are reverse transfected by overlaying them with a bait-expressing cell line and treated with ligand or left unstimulated before read-out of the luciferase activity. The gene identifiers provided in the supplementary materials were used to map the proteins, where this was not possible the gene names were used. The cDNA and interactions discussed in the publication indicate that all the proteins were from human origin hence human proteins used for interactions. Some of the identifiers provided, however, indicate mouse origin e.g. 55336 FBXL8 F-box and leucine-rich repeat protein 8". This is a mouse protein (immunoglobulin light chain). jan.tavernier@ugent.be HEK293T-derived MAPPIT prey cDNA library (hORFeome v3.1 collection). Nat. Cell Biol. (1465-7392) 2009 Only protein-protein interactions imex curation lievens-2009-4 Array MAPPIT: high-throughput interactome analysis in mammalian cells. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lievens S., Vanderroost N., Van der Heyden J., Gesellchen V., Vidal M., Tavernier J. An array MAPPIT screening was carried out. A collection of prey plasmids together with a reporter plasmid is mixed with a transfection reagent and spotted in microtiter plates to generate prey arrays. Sets of these are reverse transfected by overlaying them with a bait-expressing cell line and treated with ligand or left unstimulated before read-out of the luciferase activity. The gene identifiers provided in the supplementary materials were used to map the proteins, where this was not possible the gene names were used. The cDNA and interactions discussed in the publication indicate that all the proteins were from human origin hence human proteins used for interactions. Some of the identifiers provided, however, indicate mouse origin e.g. 55336 FBXL8 F-box and leucine-rich repeat protein 8". This is a mouse protein (immunoglobulin light chain). jan.tavernier@ugent.be HEK293T-derived MAPPIT prey cDNA library (hORFeome v3.1 collection). Nat. Cell Biol. (1465-7392) 2009 Only protein-protein interactions imex curation skp1_human S-phase kinase-associated protein 1 SKP1 EMC19 OCP2 SKP1A TCEB1L Cyclin-A/CDK2-associated protein p19 p19skp1 RNA polymerase II elongation factor-like protein Organ of Corti protein 2 Organ of Corti protein II SIII Transcription elongation factor B polypeptide 1-like protein protein human Homo sapiens Human MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK fbxw9_human F-box/WD repeat-containing protein 9 FBXW9 FBW9 F-box and WD-40 domain-containing protein 9 protein protein human Homo sapiens Human MELPLGRCDDSRTWDDDSDPESETDPDAQAKAYVARVLSPPKSGLAFSRPSQLSTPAASPSASEPRAASRVSAVSEPGLLSLPPELLLEICSYLDARLVLHVLSRVCHALRDLVSDHVTWRLRALRRVRAPYPVVEEKNFDWPAACIALEQHLSRWAEDGRWVEYFCLAEGHVASVDSVLLLQGGSLCLSGSRDRNVNLWDLRQLGTESNQVLIKTLGTKRNSTHEGWVWSLAAQDHRVCSGSWDSTVKLWDMAADGQQFGEIKASSAVLCLSYLPDILVTGTYDKKVTIYDPRAGPALLKHQQLHSRPVLTLLADDRHIISGSEDHTLVVVDRRANSVLQRLQLDSYLLCMSYQEPQLWAGDNQGLLHVFANRNGCFQLIRSFDVGHSFPITGIQYSVGALYTTSTDKTIRVHVPTDPPRTICTRRHDNGLNRVCAEGNLVVAGSGDLSLEVWRLQA fbx46_human F-box only protein 46 FBXO46 FBX46 FBXO34L F-box only protein 34-like protein protein human Homo sapiens Human MDRGSLLPFQLWCPRPFGTYSQNQPRPPSAALKPSACPEPGGGAEPDHGPAHSENTPPALATEVPASQPAPLLSAAAAGDEGRVLLDTWYVIKPGNTKEKVAFFVAHQCGGGSRASSMKVKGHWGSDSSKAKRRRRCLDPTKAPPDPGGREGPPAAEEGPASAGEDVDLLSVAEMVALVEQRAALALQSYPRPTTPAPVVFVSAEQGGPAKGVGSERRSGGGDCSRVAEAVAHFEAQRDSPPTKGLRKEERPGPGPGEVRIAFRISNGREPRAPDSGLPSGGGGRPGCAYPGSPGPGARAKDKITCDLYQLISPSRDALPSNVEFLLARADEASEGDSPAPARPEDTPPAPPPPPARDCGASGFHVDVVVTGVVDECIFFGKDGTKNVKEETVCLTVSPEEPPPPGQLFFLQNRGPDGPPEPPPADSPATAPGPDDAEGTADTSLCRLYRHVSHDFLEIRFKIQRLLEPRQYMLLLPEHVLVKIFSFLPTRALAALKCTCHHFKGIIEAFGVRATDSRWSRDPLYRDDPCKQCRKRYEKGDVSLCRWHPKPYHHDLPYGRSYWMCCRRADRETPGCRLGLHDNNWVLPCNGPGGGRAGREEGR fbw1a_human F-box/WD repeat-containing protein 1A BTRC BTRCP FBW1A FBXW1A F-box and WD repeats protein beta-TrCP E3RSIkappaB pIkappaBalpha-E3 receptor subunit Epididymis tissue protein Li 2a protein protein human Homo sapiens Human MDPAEAVLQEKALKFMCSMPRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRKIIPEKNSLRQTYNSCARLCLNQETVCLASTAMKTENCVAKTKLANGTSSMIVPKQRKLSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYLFKNKPPDGNAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTYTYISR fbxl8_human F-box/LRR-repeat protein 8 FBXL8 FBL8 F-box and leucine-rich repeat protein 8 F-box protein FBL8 protein protein human Homo sapiens Human MAEPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGMLPPYLSACLDHIHNLRLEFEPSRKPSRRAAIELLMVLAGRAPGLRGLRLECRGEKPLFDAGRDVLEAVHAVCGAASQLRHLDLRRLSFTLDDALVLQAARSCPELHSLFLDNSTLVGSVGPGSVLELLEACPRLRALGLHLASLSHAILEALAAPDRAPFALLALRCACPEDARASPLPNEAWVALRRRHPGLAVELELEPALPAESVTRVLQPAVPVAALRLNLSGDTVGPVRFAAHHYAATLCALEVRAAASAELNAALEELAARCAALREVHCFCVVSHSVLDAFRAHCPRLRTYTLKLTREPHPWRPTLVA fbw1b_human F-box/WD repeat-containing protein 11 KIAA0696 FBXW11 BTRCP2 FBW1B FBXW1B F-box/WD repeat-containing protein 1B F-box and WD repeats protein beta-TrCP2 Homologous to Slimb protein protein protein human Homo sapiens Human MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR socs2_human Suppressor of cytokine signaling 2 Cytokine-inducible SH2 protein 2 STAT-induced STAT inhibitor 2 CIS2 SSI2 STATI2 SOCS2 protein protein human Homo sapiens Human MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV eloc_mouse Elongin-C Eloc Elongin 15 kDa subunit RNA polymerase II transcription factor SIII subunit C SIII p15 Stromal membrane-associated protein SMAP1B homolog Tceb1 Transcription elongation factor B polypeptide 1 protein protein mouse Mus musculus Mouse MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC rb40b_mouse Ras-related protein Rab-40B Rab40b SOCS box-containing protein RAR protein protein mouse Mus musculus Mouse MSSLGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAGIDHKTTTILLDGRRVKLQLWDTSGQGRFCTIFRSYSRGAQGVVLVYDIANRWSFDGINRWIKEIDEHAPGVPKILVGNRLHLAFKRQVPTEQAQAYAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQELCCRAVVSCTPGHLVDKLPLPVALRSHLKSFSMASGLNTRMMHGRSYSLTANSSHKRNSFRKVRTIRPPQSPPRNCARNSCKIS asb9_human Ankyrin repeat and SOCS box protein 9 ASB9 protein protein human Homo sapiens Human MDGKQGGMDGSKPAGPRDFPGIRLLSNPLMGDAVSDWSPMHEAAIHGHQLSLRNLISQGWAVNIITADHVSPLHEACLGGHLSCVKILLKHGAQVNGVTADWHTPLFNACVSGSWDCVNLLLQHGASVQPESDLASPIHEAARRGHVECVNSLIAYGGNIDHKISHLGTPLYLACENQQRACVKKLLESGADVNQGKGQDSPLHAVARTASEELACLLMDFGADTQAKNAEGKRPVELVPPESPLAQLFLEREGPPSLMQLCRLRIRKCFGIQQHHKITKLVLPEDLKQFLLHL asb1_human Ankyrin repeat and SOCS box protein 1 ASB1 KIAA1146 protein protein human Homo sapiens Human MAEGGSPDGRAGPGSAGRNLKEWLREQFCDHPLEHCEDTRLHDAAYVGDLQTLRSLLQEESYRSRINEKSVWCCGWLPCTPLRIAATAGHGSCVDFLIRKGAEVDLVDVKGQTALYVAVVNGHLESTQILLEAGADPNGSRHHRSTPVYHASRVGRADILKALIRYGADVDVNHHLTPDVQPRFSRRLTSLVVCPLYISAAYHNLQCFRLLLLAGANPDFNCNGPVNTQGFYRGSPGCVMDAVLRHGCEAAFVSLLVEFGANLNLVKWESLGPESRGRRKVDPEALQVFKEARSVPRTLLCLCRVAVRRALGKHRLHLIPSLPLPDPIKKFLLHE fbxw5_human F-box/WD repeat-containing protein 5 F-box and WD-40 domain-containing protein 5 FBXW5 FBW5 PP3971 protein protein human Homo sapiens Human MDEGGTPLLPDSLVYQIFLSLGPADVLAAGLVCRQWQAVSRDEFLWREQFYRYYQVARDVPRHPAAMSWYEEFQRLYDTVPCVEVQTLREHTDQVLHLSFSHSGYQFASCSKDCTVKIWSNDLTISLLHSADMRPYNWSYTQFSQFNKDDSLLLASGVFLGPHNSSSGEIAVISLDSFALLSRVRNKPYDVFGCWLTETSLISGNLHRIGDITSCSVLWLNNAFQDVESENVNVVKRLFKIQNLNASTVRTVMVADCSRFDSPDLLLEAGDPATSPCRIFDLGSDNEEVVAGPAPAHAKEGLRHFLDRVLEGRAQPQLSERMLETKVAELLAQGHTKPPERSATGAKSKYLIFTTGCLTYSPHQIGIKQILPHQMTTAGPVLGEGRGSDAFFDALDHVIDIHGHIIGMGLSPDNRYLYVNSRAWPNGAVVADPMQPPPIAEEIDLLVFDLKTMREVRRALRAHRAYTPNDECFFIFLDVSRDFVASGAEDRHGYIWDRHYNICLARLRHEDVVNSVVFSPQEQELLLTASDDATIKAWRSPRTMRVLQAPRPRPRTFFSWLASQRR fbx44_human F-box only protein 44 FBXO44 FBG3 FBX30 FBX44 FBX6A FBXO6A F-box/G-domain protein 3 F-box protein FBX30 protein protein human Homo sapiens Human MAVGNINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLVTLWKRKCLREGFITEDWDQPVADWKIFYFLRSLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQVKKYFVTSYYTCLKSQVVDLKAEGYWEELMDTTRPDIEVKDWFAARPDCGSKYQLCVQLLSSAHAPLGTFQPDPATIQQKSDAKWREVSHTFSNYPPGVRYIWFQHGGVDTHYWAGWYGPRVTNSSITIGPPLP fbxl2_human F-box/LRR-repeat protein 2 F-box and leucine-rich repeat protein 2 F-box protein FBL2/FBL3 FBXL2 FBL2 FBL3 protein protein human Homo sapiens Human MVFSNNDEGLINKKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRIDLFNFQTDVEGRVVENISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDNCLLITDVALEHLENCRGLERLELYDCQQVTRAGIKRMRAQLPHVKVHAYFAPVTPPTAVAGSGQRLCRCCVIL cdca3_human Cell division cycle-associated protein 3 CDCA3 Trigger of mitotic entry protein 1 Gene-rich cluster protein C8 C8 GRCC8 TOME1 protein protein human Homo sapiens Human MGSAKSVPVTPARPPPHNKHLARVADPRSPSAGILRTPIQVESSPQPGLPAGEQLEGLKHAQDSDPRSPTLGIARTPMKTSSGDPPSPLVKQLSEVFETEDSKSNLPPEPVLPPEAPLSSELDLPLGTQLSVEEQMPPWNQTEFPSKQVFSKEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSPGTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAWEQGQDHDKENQHFPLVES fbxl6_human F-box/LRR-repeat protein 6 FBXL6 FBL6 F-box and leucine-rich repeat protein 6 F-box protein FBL6 FBL6A protein protein human Homo sapiens Human MAAPASRQVRRRARAAPRPRSAEDWWWDRLAPRGSGYHLLQSDSMLLVLSEPGPARPRAQRRASRRTPRQPPRGPSAAAKPKAGLRSEAAAAPAPAPAPTPTPEEGPDAGWGDRIPLEILVQIFGLLVAADGPMPFLGRAARVCRRWQEAASQPALWHTVTLSSPLVGRPAKGGVKAEKKLLASLEWLMPNRFSQLQRLTLIHWKSQVHPVLKLVGECCPRLTFLKLSGCHGVTADALVMLAKACCQLHSLDLQHSMVESTAVVSFLEEAGSRMRKLWLTYSSQTTAILGALLGSCCPQLQVLEVSTGINRNSIPLQLPVEALQKGCPQLQVLRLLNLMWLPKPPGRGVAPGPGFPSLEELCLASSTCNFVSNEVLGRLLHGSPNLRLLDLRGCARITPAGLQDLPCRELEQLHLGLYGTSDRLTLAKEGSPFLTQKWCHTLRELDLSGQGFSEKDLEQALAAFLSTPGGSHPALCSLNLRGTRVTPSTVSSVISSCPGLLYLNLESCRCLPRGLKRAYRGLEEVQWCLEQLLTSPSPS eloc_human Elongin-C ELOC Elongin 15 kDa subunit RNA polymerase II transcription factor SIII subunit C SIII p15 TCEB1 Transcription elongation factor B polypeptide 1 protein protein human Homo sapiens Human MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC spsb2_human SPRY domain-containing SOCS box protein 2 SPSB2 GRCC9 SSB2 Gene-rich cluster protein C9 protein protein human Homo sapiens Human MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRPVAQSTDGARGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDHYAALLGSNSESWGWDIGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGGTYLGPAFRGLKGRTLYPAVSAVWGQCQVRIRYLGERRAEPHSLLHLSRLCVRHNLGDTRLGQVSALPLPPAMKRYLLYQ spsb4_human SPRY domain-containing SOCS box protein 4 SPSB4 SSB4 protein protein human Homo sapiens Human MGQKLSGSLKSVEVREPALRPAKRELRGAEPGRPARLDQLLDMPAAGLAVQLRHAWNPEDRSLNVFVKDDDRLTFHRHPVAQSTDGIRGKVGHARGLHAWQINWPARQRGTHAVVGVATARAPLHSVGYTALVGSDAESWGWDLGRSRLYHDGKNQPGVAYPAFLGPDEAFALPDSLLVVLDMDEGTLSFIVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEVTMRYINGLDPEPLPLMDLCRRSIRSALGRQRLQDISSLPLPQSLKNYLQYQ skp1-fbxw9-1 809845 n/a 809849 unspecified role unspecified role bait bait n/a 809850 unspecified role unspecified role prey prey physical association physical association false false false 4a skp1-fbx46 809845 n/a 809849 unspecified role unspecified role bait bait n/a 809851 unspecified role unspecified role prey prey physical association physical association false false false 4a skp1-btrc 809845 n/a 809849 unspecified role unspecified role bait bait n/a 809852 unspecified role unspecified role prey prey physical association physical association false false false 4a skp1-fbxl8-1 809845 n/a 809853 unspecified role unspecified role prey prey n/a 809849 unspecified role unspecified role bait bait physical association physical association false false false 4a skp1-fbxw11 809845 n/a 809854 unspecified role unspecified role prey prey n/a 809849 unspecified role unspecified role bait bait physical association physical association false false false 4a eloc-socs2 809845 n/a 809855 unspecified role unspecified role prey prey n/a 809856 unspecified role unspecified role bait bait physical association physical association false false false 4b eloc-rab40b 809845 n/a 809857 unspecified role unspecified role prey prey n/a 809856 unspecified role unspecified role bait bait physical association physical association false false false 4b eloc-asb9 809845 n/a 809858 unspecified role unspecified role prey prey n/a 809856 unspecified role unspecified role bait bait physical association physical association false false false 4b eloc-asb1 809845 n/a 809859 unspecified role unspecified role prey prey n/a 809856 unspecified role unspecified role bait bait physical association physical association false false false 4b skp1-fbxl8 809846 n/a 809853 unspecified role unspecified role prey prey n/a 809849 unspecified role unspecified role bait bait physical association physical association false false false Table 1 skp1-fbxl15 809846 n/a 809853 unspecified role unspecified role prey prey n/a 809849 unspecified role unspecified role bait bait physical association physical association false false false Table 1 skp1-fbxw5 809846 n/a 809860 unspecified role unspecified role prey prey n/a 809849 unspecified role unspecified role bait bait physical association physical association false false false Table 1 skp1-fbx044 809846 n/a 809861 unspecified role unspecified role prey prey n/a 809849 unspecified role unspecified role bait bait physical association physical association false false false Table 1 skp1-fbx02 809846 n/a 809849 unspecified role unspecified role bait bait n/a 809862 unspecified role unspecified role prey prey physical association physical association false false false Table 1 skp1-cdca3 809846 n/a 809863 unspecified role unspecified role prey prey n/a 809849 unspecified role unspecified role bait bait physical association physical association false false false Table 1 skp1-fbxl6 809846 n/a 809864 unspecified role unspecified role prey prey n/a 809849 unspecified role unspecified role bait bait physical association physical association false false false Table 1 skp1-fbxw9 809846 n/a 809850 unspecified role unspecified role prey prey n/a 809849 unspecified role unspecified role bait bait physical association physical association false false false Table 1 skp1-fbxw11-1 809847 n/a 809849 unspecified role unspecified role bait bait e tagged tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 809854 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5 skp1-fbxw9-2 809847 n/a 809849 unspecified role unspecified role bait bait e tagged tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 809850 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5 skp1-fbx046 809847 n/a 809849 unspecified role unspecified role bait bait e tagged tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 809851 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5 eloc-socs2-1 809848 n/a 809865 unspecified role unspecified role prey prey n/a 809855 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5 eloc-spsb2 809848 n/a 809865 unspecified role unspecified role prey prey n/a 809866 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5 eloc-spsb4 809848 n/a 809865 unspecified role unspecified role prey prey n/a 809867 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5