IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wang-2009-2 The mechanism of Ca2+ -dependent regulation of kinesin-mediated mitochondrial motility. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang X., Schwarz TL. Tagged proteins were identified by anti-tag antibodies Source of KIF5C taken from PMID: 16835241 as given in the text thomas.schwarz@childrens.harvard.edu Cell (0092-8674) 2009 Only protein-protein interactions 9 imex curation wang-2009-3 The mechanism of Ca2+ -dependent regulation of kinesin-mediated mitochondrial motility. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. solution sedimentati cosedimentation in solution solution sedimentati western blot western blot Immuno blot Immuno blot Wang X., Schwarz TL. Cell lysates were incubated with 20 mM Taxol and 0.1 mg/ml polymerized microtubules for 30 min at room temperature without ATP. The microtubule pellet and bound proteins were collected by centrifugation at 21,000 g for 30 min through a 10% sucrose cushion. Tagged proteins were identified by anti-tag antibodies Source of KIF5C taken from PMID: 16835241 as given in the text thomas.schwarz@childrens.harvard.edu Cell (0092-8674) 2009 Only protein-protein interactions 9 imex curation wang-2009-1 The mechanism of Ca2+ -dependent regulation of kinesin-mediated mitochondrial motility. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang X., Schwarz TL. Source of KIF5C taken from PMID: 16835241 as given in the text thomas.schwarz@childrens.harvard.edu Cell (0092-8674) 2009 Only protein-protein interactions 9 imex curation wang-2009-4 The mechanism of Ca2+ -dependent regulation of kinesin-mediated mitochondrial motility. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Wang X., Schwarz TL. Source of KIF5C taken from PMID: 16835241 as given in the text thomas.schwarz@childrens.harvard.edu Cell (0092-8674) 2009 Only protein-protein interactions 9 imex curation miro1_human Mitochondrial Rho GTPase 1 Ras homolog gene family member T1 Rac-GTP-binding protein-like protein RHOT1 ARHT1 protein protein human Homo sapiens Human MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERVPTHIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIETCVECSAKNLKNISELFYYAQKAVLHPTGPLYCPEEKEMKPACIKALTRIFKISDQDNDGTLNDAELNFFQRICFNTPLAPQALEDVKNVVRKHISDGVADSGLTLKGFLFLHTLFIQRGRHETTWTVLRRFGYDDDLDLTPEYLFPLLKIPPDCTTELNHHAYLFLQSTFDKHDLDRDCALSPDELKDLFKVFPYIPWGPDVNNTVCTNERGWITYQGFLSQWTLTTYLDVQRCLEYLGYLGYSILTEQESQASAVTVTRDKKIDLQKKQTQRNVFRCNVIGVKNCGKSGVLQALLGRNLMRQKKIREDHKSYYAINTVYVYGQEKYLLLHDISESEFLTEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYPHVTQADLKSSTFWLRASFGATVFAVLGFAMYKALLKQR kif5c_rat Kinesin heavy chain isoform 5C Kinesin heavy chain neuron-specific 2 Kif5c Nkhc2 protein protein rat Rattus norvegicus (Rat) Rat MADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGEETVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKV trak1_human Trafficking kinesin-binding protein 1 Protein Milton TRAK1 KIAA1042 OIP106 106 kDa O-GlcNAc transferase-interacting protein protein protein human Homo sapiens Human MALVFQFGQPVRAQPLPGLCHGKLIRTNACDVCNSTDLPEVEIISLLEEQLPHYKLRADTIYGYDHDDWLHTPLISPDANIDLTTEQIEETLKYFLLCAERVGQMTKTYNDIDAVTRLLEEKERDLELAARIGQSLLKKNKTLTERNELLEEQVEHIREEVSQLRHELSMKDELLQFYTSAAEESEPESVCSTPLKRNESSSSVQNYFHLDSLQKKLKDLEEENVVLRSEASQLKTETITYEEKEQQLVNDCVKELRDANVQIASISEELAKKTEDAARQQEEITHLLSQIVDLQKKAKACAVENEELVQHLGAAKDAQRQLTAELRELEDKYAECMEMLHEAQEELKNLRNKTMPNTTSRRYHSLGLFPMDSLAAEIEGTMRKELQLEEAESPDITHQKRVFETVRNINQVVKQRSLTPSPMNIPGSNQSSAMNSLLSSCVSTPRSSFYGSDIGNVVLDNKTNSIILETEAADLGNDERSKKPGTPGTPGSHDLETALRRLSLRRENYLSERRFFEEEQERKLQELAEKGELRSGSLTPTESIMSLGTHSRFSEFTGFSGMSFSSRSYLPEKLQIVKPLEGSATLHHWQQLAQPHLGGILDPRPGVVTKGFRTLDVDLDEVYCLNDFEEDDTGDHISLPRLATSTPVQHPETSAHHPGKCMSQTNSTFTFTTCRILHPSDELTRVTPSLNSAPTPACGSTSHLKSTPVATPCTPRRLSLAESFTNTRESTTTMSTSLGLVWLLKERGISAAVYDPQSWDRAGRGSLLHSYTPKMAVIPSTPPNSPMQTPTSSPPSFEFKCTSPPYDNFLASKPASSILREVREKNVRSSESQTDVSVSNLNLVDKVRRFGVAKVVNSGRAHVPTLTEEQGPLLCGPPGPAPALVPRGLVPEGLPLRCPTVTSAIGGLQLNSGIRRNRSFPTMVGSSMQMKAPVTLTSGILMGAKLSKQTSLR kinh_rat Kinesin-1 heavy chain Kif5b Ubiquitous kinesin heavy chain Conventional kinesin heavy chain Khc protein protein rat Rattus norvegicus (Rat) Rat MADPAECNIKVMCRFRPLNESEVNRGDKYVAKFQGEDTVMIASKPYAFDRVFQSSTSQEQVYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVMDTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVICCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQWKKKYEKEKEKNKTLRNTIQWLENELNRWRNGETVPIDEQFDKEKANLEAFTADKDVAITNDKPAAAIGMAGSFTDAERRKCEEEIAKLYKQLDDKDEEINQQSQLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIGIAVGNNDVKQPEGTGMIDEEFTVARLYISKMKSEVKTMVKRCKQLESTQTESNKKMEENEKELAACQLRISQHEAKIKSLTEYLQNVEQKKRQLEESVDSLGEELVQLRAQEKVHEMEKEHLNKVQTANEVKQAVEQQIQSHRETHQKQISSLRDEVEAKEKLITDLQDQNQKMVLEQERLRVEHERLKAVDQEKSRKLHELTVMQDRREQARQDLKGLEETVAKELQTLHNLRKLFVQDLATRVKKSAEVDSDDTGGSAAQKQKISFLENNLEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENASRDRKRYQQEVDRIKEAVRSKNMARRGHSAQIAKPIRPGQHPAASPTHPGAVRGGGSFVQNNQPVGLRGGGGKQA miro_drome Mitochondrial Rho GTPase CG5410 Miro protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MGQYTASQRKNVRILLVGDAGVGKTSLILSLVSEEYPEEVPPRAEEITIPANVTPEQVPTSIVDFSAVEQSEDALAAEINKAHVVCIVYAVDDDDTLDRITSHWLPLVRAKCNPSLDGEGDAEAEAEGDTQREPIRKPIVLVGNKIDLIEYSTMDSVLAIMEDYPEIESCVECSAKSLHNISEMFYYAQKAVLHPTSPLYMMEEQELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQRRCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFSTCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSLKTNKKELYTKLATMAAFPHLRQFGLMTEDPKLWLKAGLGVAAATMLGFIVLKTISAAGAHTR kif5c_human Kinesin heavy chain isoform 5C Kinesin heavy chain neuron-specific 2 KIF5C KIAA0531 NKHC2 protein protein human Homo sapiens Human MADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKEKNKTLKNVIQHLEMELNRWRNGEAVPEDEQISAKDQKNLEPCDNTPIIDNIAPVVAGISTEEKEKYDEEISSLYRQLDDKDDEINQQSQLAEKLKQQMLDQDELLASTRRDYEKIQEELTRLQIENEAAKDEVKEVLQALEELAVNYDQKSQEVEDKTRANEQLTDELAQKTTTLTTTQRELSQLQELSNHQKKRATEILNLLLKDLGEIGGIIGTNDVKTLADVNGVIEEEFTMARLYISKMKSEVKSLVNRSKQLESAQMDSNRKMNASERELAACQLLISQHEAKIKSLTDYMQNMEQKRRQLEESQDSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQDAEEMKKALEQQMESHREAHQKQLSRLRDEIEEKQKIIDEIRDLNQKLQLEQEKLSSDYNKLKIEDQEREMKLEKLLLLNDKREQAREDLKGLEETVSRELQTLHNLRKLFVQDLTTRVKKSVELDNDDGGGSAAQKQKISFLENNLEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENAMRDRKRYQQEVDRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASSPTAVHAIRGGGGSSSNSTHYQK milt_drome Trafficking kinesin-binding protein milt milt Protein milton CG43227 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTHVNNGEVMEKEMEPTGERERDRETAAGSGVHHRFLASASERDANSGNALEAAATKTKTGTTITNLEDLAFEACQNWSDLHQDFFITDDELEYEDELSLGSSIGGNIATTTTADAAVEGLITGEHQNEQLLMEVLCGNRVSQMTRAYDDIEAVTRLLEEKEKDLELTVQIGKELLTQNNALEARVADLETDLKASNDDRAQLVHELHKKNELISVLTNDADDGTDTDTPTMSKSITLDLLQRKVNSLLDENKSLKCEATQLAHQTDEVEEHERQLMADISAQLNDANSQYDNLSLELERQREENRLQHEQIVNLTARLAEAEMRLHQLTQDNDEHLSLLHVTKENQNALALELVEFKQRYEEVLALLHSAQDQLKQQRKRSQPQARSSFLGGLGTSGAGMGGSLFPPDSLHCELMESSLYSENSLDSGISGDSQRSADRISRMMMHMPSGGMSSSTMGGSVYAGAGNVPPYKRVFDTVRCAGKSGNYMDSGNVSMTQLGAMSMSSSSGPRMASMAYPAGSYYRGGSNQSLGVKTLSSESLNSQSDDGYPAQPSGVPGAPGAKELEAALKRLTPAEVLARRAMLSYAPAGTYNYDEPMGHGTGNVRNSDLPLGVRTPDSIMSTGSSGMSGSTNHMSASMTHQWRLPEKLQIIKPMEGSQTLHHWSRLATPTLSGLLDERPGVTIRGGRGLDDLGMQIYTLSDVEEDVSDDLPGKQFEAPGCTFTYTNSMVMHPDDGFVNDLSFLSQSQMSSRMASTSTSRQPSCPATPRAGLSRKNSCSTFSVNLGLAGMLNERGIKAVTPSALNTPAGPNFSPTVTPCNSPEGSPPRAQSPEPLFGLLSCGADLIRRKIVGDQHQQQQQKQRSSLSKQQQQKIMLSHLERRALRSLNLIEKVESIGLENIISAQRGLGSGIANRSSSPLSSGSLQSLHTSSNSIVDDIHFDRAQIKGVLHRGLKSPTPATASTSAAAAASGPGISTSSSTSAYNSDDSDDQGLVMKIKPSKSATPTTTGAAQSQPSSATTSNGTASETRLKQMQRQKSRRQLKNGMANQRPDLGTISGAGGGGRVRPDLGKVADSGSSSKLSTKRSEAKPAEEEEATPQTITQAFVGSVSSLLFGRKGGWL rhot1-trak1-3 Interaction between RHOT1 (MIRO1), TRAK1 (MILTON) and KIF5C proteins identified by coimmunoprecipitation 795754 n/a 795758 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 795759 unspecified role unspecified role bait bait region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 795760 unspecified role unspecified role prey prey association association false false false The co-immunoprecipitation of TRAK1 (MILTON) and KHC from HEK cells requires the presence of RHOT1 (MIRO). Figs. 1D, 4G, 6A The interaction is not calcium dependent rhot1-kif5c-2 Interaction between RHOT1 (MIRO1) and KIF5C proteins identified by coimmunoprecipitation 795754 n/a 795758 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q8IXI2:p.[Glu208Lys;Glu328Lys] EF-hand-disruption mutant mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 795759 unspecified role unspecified role bait bait region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false The co-immunoprecipitation of RHOT1 (MIRO) and KHC from HEK cells requires the presence of calcium. Figs. 6A rhot1-kif5b-1 Interaction between RHOT1 (MIRO1) and Kif5b proteins identified by coimmunoprecipitation 795754 n/a 795761 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 795762 unspecified role unspecified role prey prey region transmembrane domain deleted sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range certain certain sequence position certain false certain certain sequence position certain range range false region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q8IMX7:p.[Glu234Lys;Asp345Lys] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false The co-immunoprecipitation of Miro and Kif5b from HEK cells requires the presence of calcium. Figs. 6D Exact coordinates of the transmembrane domain of Miro were not given in the paper and have been inferred from the UniProtKB entry. rhot1-kif5c-3 Interaction between RHOT1 (MIRO1) and KIF5C proteins identified by coimmunoprecipitation 795754 n/a 795758 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q8IXI2:p.[Glu208Lys;Glu328Lys] EF-hand-disruption mutant mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 795759 unspecified role unspecified role bait bait region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false The co-immunoprecipitation of RHOT1 (MIRO) and KHC from HEK cells requires the presence of calcium. Figs. 6A rhot1-kifc-1 Interaction between RHOT1 (MIRO1) and KIF5C proteins identified by coimmunoprecipitation 795754 n/a 795758 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 795763 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false The co-immunoprecipitation of RHOT1 (MIRO) and KHC from HEK cells requires the presence of calcium. Figs. 6G, 6L rhot1-trak1-5 Interaction between RHOT1 (MIRO1), TRAK1 (MILTON) and KIF5C proteins identified by solution sedimentation 795755 n/a 795758 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q8IXI2:p.[Glu208Lys;Glu328Lys] EF-hand-disruption mutant mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 795764 unspecified role unspecified role neutral component neutral component n/a 795759 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false When KHC was present without cotransfected milton and Miro, it was exclusively found in the microtubule pellet, whether or not Ca2+ was present. When KHC was coexpressed with milton and Miro, however, Ca2+ caused a substantial shift of KHC, together with the adaptor proteins, to the soluble fraction. Fig. 5 rhot1-trak1-9 Interaction between RHOT1 (MIRO1) and KIF5C proteins identified by cosedimentation 795755 n/a 795758 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q8IXI2:p.[Glu208Lys;Glu328Lys] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 795763 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false The co-immunoprecipitation of RHOT1 (MIRO) and KHC from HEK cells requires the presence of calcium. Figs. 6I, 6J, 6K rhot1-trak1-4 Interaction between RHOT1 (MIRO1), TRAK1 (MILTON) and kinesin heavy chain proteins identified by coimmunoprecipitation 795756 n/a 795758 unspecified role unspecified role bait bait n/a 795760 unspecified role unspecified role prey prey association association false false false Kinesin heavy chains were also identified in the immunoprecipitate but could not be ascribed to a specific gene product Fig. 1B rhot1-if5c-2 Colocalisation of milt and KIF5C 795757 n/a 795758 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 795759 unspecified role unspecified role neutral component neutral component region mCit tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Co-localisation requires the presence of a drsophila Milton orthologue Supp. Fig. 2