MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint ikushima-2008-2 An Id-like molecule, HHM, is a synexpression group-restricted regulator of TGF-beta signalling. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ikushima H., Komuro A., Isogaya K., Shinozaki M., Hellman U., Miyazawa K., Miyazono K. EMBO J. (0261-4189) 2008 Only protein-protein interactions imex curation ikushima-2008-1 An Id-like molecule, HHM, is a synexpression group-restricted regulator of TGF-beta signalling. mouse-nmumg Mus musculus NMuMG mammary gland epithelial cells nmumg NMuMG mammary gland epithelial cells anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Ikushima H., Komuro A., Isogaya K., Shinozaki M., Hellman U., Miyazawa K., Miyazono K. EMBO J. (0261-4189) 2008 Only protein-protein interactions imex curation olig1_human Oligodendrocyte transcription factor 1 OLIG1 BHLHB6 BHLHE21 Class B basic helix-loop-helix protein 6 Class E basic helix-loop-helix protein 21 protein protein human Homo sapiens Human MYYAVSQARVNAVPGTMLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGEGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSLALDEPPCGQFALPGGGAGGPGLCTCAVCKFPHLVPASLGLAAVQAQFSK smad2_human Mothers against decapentaplegic homolog 2 SMAD2 MADH2 MADR2 Mad-related protein 2 SMAD family member 2 JV18-1 protein protein human Homo sapiens Human MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS ccdb1_mouse Cyclin-D1-binding protein 1 Ccndbp1 Dip1 Gcip Maid Grap2 and cyclin-D-interacting protein Maternal Id-like protein Stage specific embryonic cDNA-8 protein protein protein mouse Mus musculus Mouse MASSTAAVPFLAPPLEQLRHLAEELRSLLPRVRVGEAQETAEEFNREMFWRRLNEAAVKVNGEATVLTTHFSKLPWPSPQETQRICEQVRIAIEEIIIVYYSLPKDQGITLRKLVRNAALDIVDGMAQLLEVLLTAPSQSTENGDLISCNSVSVACQQVPEIPKDNKAAALLMLTKSVDFVKDAHEEMEQAVEECDPYSGLLNDSEDNSDSHSDEDGVLGLPSNRDSYWSEEDQELIIPCLALVRASRASLKKIRILVAENGKKDEVAQLDDIVDISDEISPSVDDLVLSIYPPVCHLTVRISSAKLVSVLIKALEITKASHVSPHPGDSWIPLLINAVDHCMNRIKALTQRAAEL mint olig1_mouse Oligodendrocyte transcription factor 1 Olig1 Oligodendrocyte-specific bHLH transcription factor 1 protein protein mouse Mus musculus Mouse MYYAISQARVNAAPATMLRPQRPGDVQLGASLYELVGYRQPPISSSSSSSSSTASLLPKPAREKAEAPLAEPRGPAPESGGARADAKEEQQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGDGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPETLRPTKYLSLALDEPPCGQFSLPAGGAGSPGLCSCAVCKFPHLVPAGLGLAAVQAQFSK smad2-olig1 860514 olig1_human OLIG1 860516 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false smad2_human SMAD2 860517 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F4A homomint mint smad2-olig1-1 860514 olig1_human OLIG1 860516 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false smad2_human SMAD3 860517 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F4A homomint mint olig1-ccndbp1 860515 ccdb1_mouse HHM 860518 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level olig1_mouse Olig1 860519 predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F3A homomint mint