MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint nonis-2008-2 Ataxin-2 associates with the endocytosis complex and affects EGF receptor trafficking. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Nonis D., Schmidt MH., van de Loo S., Eich F., Dikic I., Nowock J., Auburger G. only a selection of interactions described in this publication have been curated SH3 Cell. Signal. (0898-6568) 2008 partial coverage mimix curation mimix curation nonis-2008-1 Ataxin-2 associates with the endocytosis complex and affects EGF receptor trafficking. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Nonis D., Schmidt MH., van de Loo S., Eich F., Dikic I., Nowock J., Auburger G. only a selection of interactions described in this publication have been curated SH3 Cell. Signal. (0898-6568) 2008 partial coverage mimix curation mimix curation nonis-2008-3 Ataxin-2 associates with the endocytosis complex and affects EGF receptor trafficking. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Nonis D., Schmidt MH., van de Loo S., Eich F., Dikic I., Nowock J., Auburger G. only a selection of interactions described in this publication have been curated SH3 Cell. Signal. (0898-6568) 2008 partial coverage mimix curation mimix curation nonis-2008-4 Ataxin-2 associates with the endocytosis complex and affects EGF receptor trafficking. mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Nonis D., Schmidt MH., van de Loo S., Eich F., Dikic I., Nowock J., Auburger G. only a selection of interactions described in this publication have been curated SH3 Cell. Signal. (0898-6568) 2008 partial coverage mimix curation mimix curation atx2_human Ataxin-2 Spinocerebellar ataxia type 2 protein Trinucleotide repeat-containing gene 13 protein SCA2 TNRC13 ATXN2 ATX2 protein protein human Homo sapiens Human MRSAAAAPRSPAVATESRRFAAARWPGWRSLQRPARRSGRGGGGAAPGPYPSAAPPPPGPGPPPSRQSSPPSASDCFGSNGNGGGAFRPGSRRLLGLGGPPRPFVVLLLPLASPGAPPAAPTRASPLGARASPPRSGVSLARPAPGCPRPACEPVYGPLTMSLKPQQQQQQQQQQQQQQQQQQQQQQQPPPAAANVRKPGGSGLLASPAAAPSPSSSSVSSSSATAPSSVVAATSGGGRPGLGRGRNSNKGLPQSTISFDGIYANMRMVHILTSVVGSKCEVQVKNGGIYEGVFKTYSPKCDLVLDAAHEKSTESSSGPKREEIMESILFKCSDFVVVQFKDMDSSYAKRDAFTDSAISAKVNGEHKEKDLEPWDAGELTANEELEALENDVSNGWDPNDMFRYNEENYGVVSTYDSSLSSYTVPLERDNSEEFLKREARANQLAEEIESSAQYKARVALENDDRSEEEKYTAVQRNSSEREGHSINTRENKYIPPGQRNREVISWGSGRQNSPRMGQPGSGSMPSRSTSHTSDFNPNSGSDQRVVNGGVPWPSPCPSPSSRPPSRYQSGPNSLPPRAATPTRPPSRPPSRPSRPPSHPSAHGSPAPVSTMPKRMSSEGPPRMSPKAQRHPRNHRVSAGRGSISSGLEFVSHNPPSEAATPPVARTSPSGGTWSSVVSGVPRLSPKTHRPRSPRQNSIGNTPSGPVLASPQAGIIPTEAVAMPIPAASPTPASPASNRAVTPSSEAKDSRLQDQRQNSPAGNKENIKPNETSPSFSKAENKGISPVVSEHRKQIDDLKKFKNDFRLQPSSTSESMDQLLNKNREGEKSRDLIKDKIEPSAKDSFIENSSSNCTSGSSKPNSPSISPSILSNTEHKRGPEVTSQGVQTSSPACKQEKDDKEEKKDAAEQVRKSTLNPNAKEFNPRSFSQPKPSTTPTSPRPQAQPSPSMVGHQQPTPVYTQPVCFAPNMMYPVPVSPGVQPLYPIPMTPMPVNQAKTYRAVPNMPQQRQDQHHQSAMMHPASAAGPPIAATPPAYSTQYVAYSPQQFPNQPLVQHVPHYQSQHPHVYSPVIQGNARMMAPPTHAQPGLVSSSATQYGAHEQTHAMYACPKLPYNKETSPSFYFAISTGSLAQQYAHPNATLHPHTPHPQPSATPTGQQQSQHGGSHPAPSPVQHHQHQAAQALHLASPQQQSAIYHAGLAPTPPSMTPASNTQSPQNSFPAAQQTVFTIHPSHVQPAYTNPPHMAHVPQAHVQSGMVPSHPTAHAPMMLMTTQPPGGPQAALAQSALQPIPVSTTAHFPYMTHPSVQAHHQQQL sh3g2_human Endophilin-A1 SH3GL2 CNSA2 SH3D2A Endophilin-1 SH3 domain-containing GRB2-like protein 2 SH3 domain protein 2A EEN-B1 protein protein human Homo sapiens Human MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPH sh3g3_human Endophilin-A3 Endophilin-3 SH3 domain-containing GRB2-like protein 3 SH3 domain protein 2C EEN-B2 SH3GL3 CNSA3 SH3D2C protein protein human Homo sapiens Human MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVVKTTGSNIPMDQPCCRGLYDFEPENQGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ sh3g2_mouse Endophilin-A1 Sh3gl2 Sh3d2a Endophilin-1 SH3 domain-containing GRB2-like protein 2 SH3 domain protein 2A Een1 SH3p4 protein protein mouse Mus musculus Mouse MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFATGDSTQPNGGLSHTGTPKPPGVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVEILVALPH atx2_mouse Ataxin-2 Atxn2 Atx2 Sca2 Spinocerebellar ataxia type 2 protein homolog protein protein mouse Mus musculus Mouse MRSSTAAVQRPAAGDPEPRRPAGWAARRSLPRTARRGGRGGAVAYPSAGPPPRGPGAPPRGPRSPPCASDCFGSNGHGASRPGSRRLLGVCGPPRPFVVVLLALAPAATPARACPPGVRASPPRSGVSSSARPAPGCPRPACEPVYGPLTMSLKPQPQPPAPATGRKPGGGLLSSPGAAPASAAVTSASVVPAPAAPVASSSAAAGGGRPGLGRGRNSSKGLPQPTISFDGIYANVRMVHILTSVVGSKCEVQVKNGGIYEGVFKTYSPKCDLVLDAAHEKSTESSSGPKREEIMESVLFKCSDFVVVQFKDTDSSYARRDAFTDSALSAKVNGEHKEKDLEPWDAGELTASEELELENDVSNGWDPNDMFRYNEENYGVVSTYDSSLSSYTVPLERDNSEEFLKREARANQLAEEIESSAQYKARVALENDDRSEEEKYTAVQRNCSDREGHGPNTRDNKYIPPGQRNREVLSWGSGRQSSPRMGQPGPGSMPSRAASHTSDFNPNAGSDQRVVNGGVPWPSPCPSHSSRPPSRYQSGPNSLPPRAATHTRPPSRPPSRPSRPPSHPSAHGSPAPVSTMPKRMSSEGPPRMSPKAQRHPRNHRVSAGRGSMSSGLEFVSHNPPSEAAAPPVARTSPAGGTWSSVVSGVPRLSPKTHRPRSPRQSSIGNSPSGPVLASPQAGIIPAEAVSMPVPAASPTPASPASNRALTPSIEAKDSRLQDQRQNSPAGSKENVKASETSPSFSKADNKGMSPVVSEHRKQIDDLKKFKNDFRLQPSSTSESMDQLLSKNREGEKSRDLIKDKTEASAKDSFIDSSSSSSNCTSGSSKTNSPSISPSMLSNAEHKRGPEVTSQGVQTSSPACKQEKDDREEKKDTTEQVRKSTLNPNAKEFNPRSFSQPKPSTTPTSPRPQAQPSPSMVGHQQPAPVYTQPVCFAPNMMYPVPVSPGVQPLYPIPMTPMPVNQAKTYRAGKVPNMPQQRQDQHHQSTMMHPASAAGPPIVATPPAYSTQYVAYSPQQFPNQPLVQHVPHYQSQHPHVYSPVIQGNARMMAPPAHAQPGLVSSSAAQFGAHEQTHAMYACPKLPYNKETSPSFYFAISTGSLAQQYAHPNAALHPHTPHPQPSATPTGQQQSQHGGSHPAPSPVQHHQHQAAQALHLASPQQQSAIYHAGLAPTPPSMTPASNTQSPQSSFPAAQQTVFTIHPSHVQPAYTTPPHMAHVPQAHVQSGMVPSHPTAHAPMMLMTTQPPGPKAALAQSALQPIPVSTTAHFPYMTHPSVQAHHQQQL mint sh3gl2-atxn2 867026 atx2_human atxn2 867030 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate sh3g2_human endoA1 867031 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false homomint domino mint f1c f1d f1e f3b sh3gl3-atxn2 867026 atx2_human atxn2 867030 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate sh3g3_human endoA3 867032 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false homomint domino mint f1c f1d f1e f3c sh3gl3-atxn2-1 867026 atx2_human atxn2 867030 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sh3g3_human endoA3 867032 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false homomint domino mint f5 c f5e sh3gl3-atxn2-2 867026 atx2_human atxn2 867030 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sh3g3_human endoA3 867032 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false homomint domino mint f5 c f5e sh3gl2-atxn2-1 867026 atx2_human atxn2 867030 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sh3g2_human endoA1 867031 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false homomint domino mint f5 c f5e sh3gl2-atxn2-2 867026 sh3g2_mouse endoA1 867033 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false atx2_human atxn2 867030 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false homomint domino mint f5 c f5e atxn2-sh3gl2-1 867027 atx2_human atxn2 867030 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sh3g2_human endoA1 867031 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1a f1b homomint mint atxn2-sh3gl3-2 867027 sh3g3_human endoA3 867032 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false atx2_human atxn2 867030 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1a f1b homomint mint sh3gl2-atxn2-3 867028 atx2_human atxn2 867030 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false sh3g2_human endoA1 867031 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1f homomint mint atxn2-sh3gl2-2 867028 sh3g2_human endoA1 867031 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false atx2_human atxn2 867030 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1f homomint mint sh3gl2-atxn2-4 867029 atx2_mouse atxn2 867034 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level sh3g2_mouse endoA1 867033 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false mint f2d f2e