IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ maple-2005-1 Plastid division is mediated by combinatorial assembly of plastid division proteins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Maple J., Aldridge C., Moller SG. sgm5@le.ac.uk Plant J. (0960-7412) 2005 Only protein-protein interactions imex curation maple-2005-3 Plastid division is mediated by combinatorial assembly of plastid division proteins. tobac Nicotiana tabacum (Common tobacco) Common tobacco bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Maple J., Aldridge C., Moller SG. sgm5@le.ac.uk Plant J. (0960-7412) 2005 Only protein-protein interactions imex curation maple-2005-2 Plastid division is mediated by combinatorial assembly of plastid division proteins. tobac Nicotiana tabacum (Common tobacco) Common tobacco fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Maple J., Aldridge C., Moller SG. sgm5@le.ac.uk Plant J. (0960-7412) 2005 Only protein-protein interactions imex curation mind1_arath Putative septum site-determining protein minD homolog, chloroplastic MIND1 At5g24020 ARC11 Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 11 Septum site-determining protein MinD1 MZF18.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASLRLFSTNHQSLLLPSSLSQKTLISSPRFVNNPSRRSPIRSVLQFNRKPELAGETPRIVVITSGKGGVGKTTTTANVGLSLARYGFSVVAIDADLGLRNLDLLLGLENRVNYTCVEVINGDCRLDQALVRDKRWSNFELLCISKPRSKLPMGFGGKALEWLVDALKTRPEGSPDFIIIDCPAGIDAGFITAITPANEAVLVTTPDITALRDADRVTGLLECDGIRDIKMIVNRVRTDMIKGEDMMSVLDVQEMLGLSLLGVIPEDSEVIRSTNRGFPLVLNKPPTLAGLAFEQAAWRLVEQDSMKAVMVEEEPKKRGFFSFFGG mine1_arath Cell division topological specificity factor homolog, chloroplastic MINE1 ARC12 F10D13.22 At1g69390 Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 12 F23O10.25 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAMSSGTLRISATLVSPYHHHHRNRLSLPSSSSKVDFTGFISNGVNSLETQKCTPGLAISRENTRGQVKVLARNTGDYELSPSPAEQEIESFLYNAINMGFFDRLNLAWKIIFPSHASRRSSNARIAKQRLKMILFSDRCDVSDEAKRKIVNNIIHALSDFVEIESEEKVQLNVSTDGDLGTIYSVTVPVRRVKPEYQDVDEAGTITNVEYKDTRDGSVDVRFDFYVPE ftz22_arath Cell division protein FtsZ homolog 2-2, chloroplastic FTSZ2-2 Plastid division protein FTSZ2-2 F3C22.150 At3g52750 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAAYVSPCLTPPDSRVLTVLRKSVLPDHHLGTRVGCLRMSEGTTKRYRVVASHKYESSSIRNSLNSHSTSHFQSQDSFLNLHPEISMLNPRKETSSVPITEDLDELSTPNTYNEARIKVIGVGGGGSNAVNRMIESEMIGVEFWIVNTDIQAMRISPVFPDNRLQIGKELTRGLGAGGNPEIGMNAATESKEAIQEALYGSDMVFVTAGMGGGTGTGGAPIIAGVAKAMGILTVGIVTTPFSFEGRRRALQAQEGIAALRDNVDTLIVIPNDKLLAAVSQSTPVTEAFNLADDILRQGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDPSYSGQISITLIATGFKRQEEGEGRPLQATQADASMGATRRPSSSFTEGSSIEIPEFLKKKGRSRYPRL ftsz1_arath Cell division protein FtsZ homolog 1, chloroplastic FTSZ1 MCO15.23 At5g55280 ARC10 FTSZ1-1 PMI4 Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 10 Protein PLASTID MOVEMENT IMPAIRED4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAIIPLAQLNELTISSSSSSFLTKSISSHSLHSSCICASSRISQFRGGFSKRRSDSTRSKSMRLRCSFSPMESARIKVIGVGGGGNNAVNRMISSGLQSVDFYAINTDSQALLQSSAENPLQIGELLTRGLGTGGNPLLGEQAAEESKDAIANALKGSDLVFITAGMGGGTGSGAAPVVAQISKDAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDDRYTGEIHVTIIATGFSQSFQKTLLTDPRAAKLLDKMGSSGQQENKGMSLPHQKQSPSTISTKSSSPRRLFF arc6_arath Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 6, chloroplastic At5g42480 ARC6 MDH9.18 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEALSHVGIGLSPFQLCRLPPATTKLRRSHNTSTTICSASKWADRLLSDFNFTSDSSSSSFATATTTATLVSPPPSIDRPERHVPIPIDFYQVLGAQTHFLTDGIRRAFEARVSKPPQFGFSDDALISRRQILQAACETLSNPRSRREYNEGLLDDEEATVITDVPWDKVPGALCVLQEGGETEIVLRVGEALLKERLPKSFKQDVVLVMALAFLDVSRDAMALDPPDFITGYEFVEEALKLLQEEGASSLAPDLRAQIDETLEEITPRYVLELLGLPLGDDYAAKRLNGLSGVRNILWSVGGGGASALVGGLTREKFMNEAFLRMTAAEQVDLFVATPSNIPAESFEVYEVALALVAQAFIGKKPHLLQDADKQFQQLQQAKVMAMEIPAMLYDTRNNWEIDFGLERGLCALLIGKVDECRMWLGLDSEDSQYRNPAIVEFVLENSNRDDNDDLPGLCKLLETWLAGVVFPRFRDTKDKKFKLGDYYDDPMVLSYLERVEVVQGSPLAAAAAMARIGAEHVKASAMQALQKVFPSRYTDRNSAEPKDVQETVFSVDPVGNNVGRDGEPGVFIAEAVRPSENFETNDYAIRAGVSESSVDETTVEMSVADMLKEASVKILAAGVAIGLISLFSQKYFLKSSSSFQRKDMVSSMESDVATIGSVRADDSEALPRMDARTAENIVSKWQKIKSLAFGPDHRIEMLPEVLDGRMLKIWTDRAAETAQLGLVYDYTLLKLSVDSVTVSADGTRALVEATLEESACLSDLVHPENNATDVRTYTTRYEVFWSKSGWKITEGSVLAS mind1 824356 n/a 824359 unspecified role unspecified role prey prey n/a 824359 unspecified role unspecified role bait bait physical association physical association false false false Figure 1a mind1-mine1 824356 n/a 824359 unspecified role unspecified role bait bait n/a 824360 unspecified role unspecified role prey prey physical association physical association false false false Figure 1a mine1 824356 n/a 824360 unspecified role unspecified role bait bait n/a 824360 unspecified role unspecified role prey prey physical association physical association false false false Figure 1a mind1-mine1-3 824356 n/a 824360 unspecified role unspecified role bait bait n/a 824359 unspecified role unspecified role prey prey physical association physical association false false false Figure 1a ftsz1-ftsz2 824356 n/a 824361 unspecified role unspecified role prey prey n/a 824362 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 2a Figure 4 ftsz1-ftsz2-1 824356 n/a 824362 unspecified role unspecified role prey prey n/a 824361 unspecified role unspecified role bait bait physical association physical association false false false Figure 2a ftsz1-2 824356 n/a 824362 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 824362 unspecified role unspecified role prey prey physical association physical association false false false Figure 2a Figure 4 ftsz2-2 824356 n/a 824361 unspecified role unspecified role prey prey n/a 824361 unspecified role unspecified role bait bait physical association physical association false false false Figure 2a ftsz2-arc6 824356 n/a 824363 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 824361 unspecified role unspecified role bait bait physical association physical association false false false Figure 4 mind1-mine1-2 824357 n/a 824360 unspecified role unspecified role neutral component neutral component c-terminal C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 824359 unspecified role unspecified role neutral component neutral component c-terminal N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Figure 1c mine1-2 824357 n/a 824360 unspecified role unspecified role neutral component neutral component c-terminal N-terminal YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 824360 unspecified role unspecified role neutral component neutral component c-terminal C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false direct interaction direct interaction false false false Figure 1c mind1-3 824357 n/a 824359 unspecified role unspecified role neutral component neutral component c-terminal C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 824359 unspecified role unspecified role neutral component neutral component c-terminal N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Figure 1c ftsz2-1 824357 n/a 824361 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 824361 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 2c ftsz1-5 824357 n/a 824362 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 824362 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 2c ftsz1-ftsz2-4 824357 n/a 824361 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 824362 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 2c ftsz1-ftsz2-5 824357 n/a 824361 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 824362 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 2c ftsz2--arc6-1 824357 n/a 824363 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 824361 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 5 arc6-3 824357 n/a 824363 unspecified role unspecified role neutral component neutral component c-terminal region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 824363 unspecified role unspecified role neutral component neutral component c-terminal C-terminal region of YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Figure 5b mind1-mine1-1 824358 n/a 824360 unspecified role unspecified role neutral component neutral component n-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 824359 unspecified role unspecified role neutral component neutral component n-terminal cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false direct interaction direct interaction false false false Figure 1b mind1-2 824358 n/a 824359 unspecified role unspecified role fluorescence donor fluorescence donor n-terminal cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 824359 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept n-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false direct interaction direct interaction false false false Figure 1b mine1-1 824358 n/a 824360 unspecified role unspecified role neutral component neutral component n-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 824360 unspecified role unspecified role neutral component neutral component n-terminal cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false direct interaction direct interaction false false false Figure 1b ftsz1-ftsz2-2 824358 n/a 824361 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 824362 unspecified role unspecified role fluorescence donor fluorescence donor region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Figure 2b ftsz1-ftsz2-3 824358 n/a 824362 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 824361 unspecified role unspecified role fluorescence donor fluorescence donor region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Figure 2b ftsz1-4 824358 n/a 824362 unspecified role unspecified role fluorescence donor fluorescence donor region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 824362 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Figure 2b ftsz2 824358 n/a 824361 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 824361 unspecified role unspecified role fluorescence donor fluorescence donor region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Figure 2b ftsz1-6 824358 n/a 824362 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 824363 unspecified role unspecified role neutral component neutral component c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false direct interaction direct interaction false false false Figure 5b