IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ knop-2000-1 Role of the spindle pole body of yeast in mediating assembly of the prospore membrane during meiosis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Knop M., Strasser K. knop@biochem.mpg.de EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation knop-2000-2 Role of the spindle pole body of yeast in mediating assembly of the prospore membrane during meiosis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Knop M., Strasser K. knop@biochem.mpg.de EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation mpc70_yeast Sporulation-specific protein 21 Meiotic plaque component protein 70 SPO21 MPC70 YOL091W protein protein yeast Saccharomyces cerevisiae Baker's yeast MDNILKASNMEGTSTMTVTSRSSEDSSCISNHEQDTDTHKDGDTSGLENSKISKRKWMKEFFKLSKSPASKSSRSIGSMKSNQSLVSMKSSDDGNSYKNDYSSICGNSLPSAGLSRSNSVKELKLDSTGSQRSKNNVAMLARSSTTSQTTCSSSSSSSSYNSIKGNENDILLQNNNHFRHNKEIPQSKGSSNINTASIMSQYNVDTQATAIMSDMQKQYDSQQMTSPFVNEDLHFDPNGEVSHVIKAIFKEIGYKYDDFSDIPVFQLMQEMYQLVKKNSSARRTKITDYASKLKEKEAQLKSQNDKILKLETTNKAYKTKYKEVSLENKKIKEAFKELDNESYNHDEELLKKYKYTRETLDRVNREQQLIIDQNEFLKKSVNELQNEVNATNFKFSLFKEKYAKLADSITELNTSTKKREALGENLTFECNELKEICLKYKKNIENISNTNKNLQNSFKNERKKVLDLRNERNLLKKEILLIECHGSYSLLLVSNILTCYRFLLPSDTIIETESLIKELLNMNNSLSNHVSSSDEPPAEYSKRLELKCVEFEEKLLYFYQELVTKKIIDVIYKCFINYYKKSRQTDQKSNQNSSTPYKQSQRQVPHSIK E216B0C9B865B412 mpc54_yeast Meiotic plaque component protein 54 MPC54 YOR177C protein protein yeast Saccharomyces cerevisiae Baker's yeast MPEDTSYSNSFEDYYNNSHAISPYKDSFYKEMTPSKPNVRFGDDDVNIFDQRKKVNEINKNNTVKRSIPSSISTTITPNKSSLKSPRGKRASKNSFDNETKLESKNETLKEVNDAVNRCYALCNIPTKHVSINSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKELNEKSLQMAIDHLLKVTKQNLRQADDGNKLKETEALKSFIEEIEEVDDNKISINSLQQQLLEEKTANNILRRDYYKLQERGRRLCHEFQELQDDYSKQMKQKEYEVQKLKNEIKVLLNMNDNLKAEKAHYSQKEKQYFQKYTYIEKYMNHVKEEYNRKEDECKKLNFIIDKSMKKIEHLERSLQTQFTAQNSFSTAMIQEEGPKDAHLKDRYHKVKEFMEQKLQTSKINDPSCSEAEALDNVLCLIESSMKTLDKNSKCYPIATKKCIKYVTDSPRLKENEHVTN 74C614223B385CAC nud1_yeast Protein NUD1 YOR373W NUD1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDMDTQEAELSSQLENLTINSPRKLRSNAHSNSGKVFKEYESNHDFQDSNFTSQVVEPAISDSVKKPPTMTVLNNYSTVHQKVPSGFSGTTATSHQEAQWKQYFPGIGSGGGTNFGGAVGTANKVPESDLIVSDLVKDLSGVLETNTFKRHLDMKNKTTTMQTHENHDTISISHSKDFFNAEKVSSSFSDDSDSGPAAEAHDVFDGILQKQKSNYLVGSYPSNSNNKNNNNNNNNNNNNSININNKDNARTKEEDEEDTSNSFEFSSSSSMSSSQTQSGRKSKVLKKPPLNTISPGQLGYQFNHTHGAWDPPLNQGLDVSSSHSLDNTSSNQSQFATMVPTGDNHTNGKAPSILDKKAYELTSTKPGDVGYRQKKIQEEENLANSDDTPLDTPKFNDLFTKNGTRAKVKGQMRTSRSISNSNLLEAHKKLKTFPAERVEDITSISEVNTSFNETEKQLISILTSKLSGSPSYDSDWEKILKVDLSRGKLKNMFGMQRLLPNVLVLNLSDNEMNTLEGIPSNVVQLFCSNNKITSAHCSLAGFHDLECLDLSYNLLNTSLKFLSLCHHLQEVNLSYNSIQSLEGIGSSRMKKLNLSNNEINGIIDFEQLILTNNSVVGGWLTVEVLDLSNNNIIGVRNINCLPRLKVLNLNGNPLVSIVESSKMENGTLRALSIKNTGGALSKLQNYKLDDQFTFPYQNLKILKLDGFAQLSKWQKWPATLQILEINGGLASSLPRFSSLKSTNLYSLTIANVRDFTHLPVDLSKELPFLQELHLPGNNLQNAHKLTKTLPRQSVKFLDLRNNPITTPRHDRASTSLHYRQLLQLAGLCQQQCPALATLWLDDTPAPTATNL spc42_yeast Spindle pole body component SPC42 SPC42 YKL255 YKL042W protein protein yeast Saccharomyces cerevisiae Baker's yeast MNGSPTPKRYSSKSSRLYDDYYNIPYQYSNPTPMNRDYNDVGSRINADKLVPEEYKRNTEFINKAVQQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDITKKLEDQNLNLQIKISDLEKKLSDANSTFKEMRFPKVKDPMVDDDPVSENYDQINVPKHRAPDATGNPRTTNKVSNTSDQDSRLKAIERTLSVLTNYVMRSEDGNNDRMSPLPSPLNTILPINNRLNFQEPKRYNPTVKVNPSDDDIMMYESAELKRVEEEIEELKRKILVRKKHDLRKLSLNNQLQELQSMMDGDDNIKLDNVSKHNHATHRHSSQSSRDYSPSSDACLECSNDLYEKNRVKPENNMSETFATPTPNNR cnm67_yeast Chaotic nuclear migration protein 67 CNM67 N1264 YNL225C protein protein yeast Saccharomyces cerevisiae Baker's yeast MTDFDLMNFPFHERLDSPVSENGEIKDGEPIPQNWLNENHVGKSILPLFVNPEDVINCNFSNARDSYEENKSPSMDQMNYARNTSYQESPGLQERPKNEKDKSPIGTDVHKKDVPNFIHSTPRENSSKHFTRANEQASAQPTDEHTSPDISIEDCNGAKIFLQNSLSKEDFRMLENVILGYQKKVIELGRDNLRQEERANSLQKELEAATKSNDKTLDNKKKIEEQTVLIENLTKDLSLNKEMLEKANDTIQTKHTALLSLTDSLRKAELFEIPIGILFFDLYDSEENSSKLDHILQEKYPNIKGFLCASQQEELSRISQRFKNAKAEAEDLRNELENKKIEIQTMREKNNTLIGTNKTLSKQNKILCDKFDKLTIDEKEILKGCNEEIKIKLERLNERLGSWEKSKEKYETSLKDKEKMLADAEKKTNTLSKELDNLRSRFGNLEGNTSERITIKNILQSRPDISAEECNFLMVEQIDSANLTTLQNTVKEIVLAVGIPYPKLRRKIPLLAIKLKYENIMLSNFAQRLHRQVYSQEMNLKKFTDQAYYDFMSTRRMDSIDHHLERCLDHLYDHILEKMVK C4DE7631A70E695A mpc70-mpc70 Interaction between Mpc70 and Mpc70 796729 n/a 796731 unspecified role unspecified role prey prey n/a 796731 unspecified role unspecified role bait bait physical association physical association false false false Figure 4a mpc70-mpc54 Interaction between Mpc70 and Mpc54 796729 n/a 796731 unspecified role unspecified role bait bait n/a 796732 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 4a mpc70-nud1 Interaction between Mpc70 and Nud1 796729 n/a 796731 unspecified role unspecified role prey prey n/a 796733 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 4a mpc70-spc42 Interaction between Mpc70 and Spc42 796729 n/a 796731 unspecified role unspecified role bait bait n/a 796734 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 4a mpc70-cnm67 Interaction between Mpc70 and Cnm67 796729 n/a 796735 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 796731 unspecified role unspecified role prey prey physical association physical association false false false Figure 4a mpc54-mpc54 Interaction between Mpc54 and Mpc54 796729 n/a 796732 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 796732 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false 796759 796757 physical association physical association false false false Figure 4a mpc54-nud1 Interaction between Mpc54 and Nud1 796729 n/a 796732 unspecified role unspecified role prey prey n/a 796733 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 4a mpc54-spc42 Interaction between Mpc54 and Spc42 796729 n/a 796734 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 796732 unspecified role unspecified role bait bait physical association physical association false false false Figure 4a mpc70-mpc54-1 Interaction between Mpc70 and Mpc54 796729 n/a 796732 unspecified role unspecified role bait bait n/a 796731 unspecified role unspecified role prey prey physical association physical association false false false Figure 4a mpc70-nud1-1 Interaction between Mpc70 and Nud1 796729 n/a 796733 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 796731 unspecified role unspecified role bait bait physical association physical association false false false Figure 4a Mpc70p interacts strongly with the C-terminal half of Nud1p. These interactions were independent of which domain was fused to the lexA DNA-binding domain and to the Gal4 activation domain. mpc54-nud1-1 Interaction between Mpc54 and Nud1 796730 n/a 796733 unspecified role unspecified role prey prey n/a 796732 unspecified role unspecified role bait bait region protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 4b