IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ yamada-1998-1 An Arabidopsis protein that interacts with the cytokinin-inducible response regulator, ARR4, implicated in the His-Asp phosphorylay signal transduction. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yamada H., Hanaki N., Imamura A., Ueguchi C., Mizuno T. Cited contact Takeshi Mizuno. Adress:Laboratory of Molecular Microbiology, School of Agriculture, Nagoya University, Chikusa-ku, Nagoya 464-8601, Japan Arabidopsis cDNA library of 3 week old green vegetative tissue of Arabidopsis (cv. Columbia). FEBS Lett. (0014-5793) 1998 yamada-1998-2 An Arabidopsis protein that interacts with the cytokinin-inducible response regulator, ARR4, implicated in the His-Asp phosphorylay signal transduction. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yamada H., Hanaki N., Imamura A., Ueguchi C., Mizuno T. Cited contact Takeshi Mizuno. Adress:Laboratory of Molecular Microbiology, School of Agriculture, Nagoya University, Chikusa-ku, Nagoya 464-8601, Japan Arabidopsis cDNA library of 3 week old green vegetative tissue of Arabidopsis (cv. Columbia). FEBS Lett. (0014-5793) 1998 yamada-1998-3 An Arabidopsis protein that interacts with the cytokinin-inducible response regulator, ARR4, implicated in the His-Asp phosphorylay signal transduction. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yamada H., Hanaki N., Imamura A., Ueguchi C., Mizuno T. Cited contact Takeshi Mizuno. Adress:Laboratory of Molecular Microbiology, School of Agriculture, Nagoya University, Chikusa-ku, Nagoya 464-8601, Japan Arabidopsis cDNA library of 3 week old green vegetative tissue of Arabidopsis (cv. Columbia). FEBS Lett. (0014-5793) 1998 remo_arath Remorin DBP F4I18.20 At2g45820 DNA-binding protein protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAEEQKTSKVDVESPAVLAPAKEPTPAPVEVADEKIHNPPPVESKALAVVEKPIEEHTPKKASSGSADRDVILADLEKEKKTSFIKAWEESEKSKAENRAQKKISDVHAWENSKKAAVEAQLRKIEEKLEKKKAQYGEKMKNKVAAIHKLAEEKRAMVEAKKGEELLKAEEMGAKYRATGVVPKATCGCF arr4_arath Two-component response regulator ARR4 Response regulator 1 ARR4 ATRR1 IBC7 At1g10470 T10O24.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MARDGGVSCLRRSEMMSVGGIGGIESAPLDLDEVHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGLDNEKASAEFDRLKVDLIITDYCMPGMTGYELLKKIKESSNFREVPVVIMSSENVLTRIDRCLEEGAQDFLLKPVKLADVKRLRSHLTKDVKLSNGNKRKLPEDSSSVNSSLPPPSPPLTISPESSPPLTVSTESSDSSPPLSPVEIFSTSPLSSPIDDEDDDVLTSSSEESPIRRQKMRSPGLD y3126_arath Uncharacterized protein At3g61260 T20K12.160 At3g61260 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAEEQKIALESESPAKVTTPAPADTPAPAPAEIPAPAPAPTPADVTKDVAEEKIQNPPPEQIFDDSKALTVVEKPVEEPAPAKPASASLDRDVKLADLSKEKRLSFVRAWEESEKSKAENKAEKKIADVHAWENSKKAAVEAQLKKIEEQLEKKKAEYAERMKNKVAAIHKEAEERRAMIEAKRGEDVLKAEETAAKYRATGIVPKATCGCF arr4-dbp ARR4 interacts with DBP (DBP1) 744243 N/A 744246 unspecified role unspecified role prey prey N/A 744247 unspecified role unspecified role bait bait physical association physical association false false false Figure 1 arr4-at3g61260 ARR4 interacts with At3g61260 (DBP2) 744243 N/A 744247 unspecified role unspecified role bait bait N/A 744248 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 1 arr4-dbp-1 ARR4 interacts with DBP (DBP1) 744244 N/A 744246 unspecified role unspecified role prey prey c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 744247 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 2 The authors suggest that "the N-terminal region of AtDBP1 may exhibit an inhibitory effect on the interaction". arr4-dbp-2 ARR4 interacts with DBP (DBP1) 744245 N/A 744246 unspecified role unspecified role prey prey c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 744247 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 3