UniProt UniProt http://www.uniprot.org chen-1998b-1 Alpha 4 associates with protein phosphatases 2A, 4, and 6. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Chen J., Peterson RT., Schreiber SL. sls@slsiris.harvard.edu HeLa cell cDNA Biochem. Biophys. Res. Commun. (0006-291X) 1998 Only protein-protein interactions imex curation chen-1998b-3 Alpha 4 associates with protein phosphatases 2A, 4, and 6. human-jurkat Homo sapiens jurkat Human T cell leukemia anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen J., Peterson RT., Schreiber SL. sls@slsiris.harvard.edu HeLa cell cDNA Biochem. Biophys. Res. Commun. (0006-291X) 1998 Only protein-protein interactions imex curation chen-1998b-2 Alpha 4 associates with protein phosphatases 2A, 4, and 6. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chen J., Peterson RT., Schreiber SL. sls@slsiris.harvard.edu HeLa cell cDNA Biochem. Biophys. Res. Commun. (0006-291X) 1998 Only protein-protein interactions imex curation chen-1998b-4 Alpha 4 associates with protein phosphatases 2A, 4, and 6. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chen J., Peterson RT., Schreiber SL. sls@slsiris.harvard.edu HeLa cell cDNA Biochem. Biophys. Res. Commun. (0006-291X) 1998 Only protein-protein interactions imex curation chen-1998b-5 Alpha 4 associates with protein phosphatases 2A, 4, and 6. human-jurkat Homo sapiens jurkat Human T cell leukemia anti tag coip anti tag coimmunoprecipitation anti tag coip antibody detection identification by antibody antibody detection Chen J., Peterson RT., Schreiber SL. sls@slsiris.harvard.edu HeLa cell cDNA Biochem. Biophys. Res. Commun. (0006-291X) 1998 Only protein-protein interactions imex curation igbp1_human Immunoglobulin-binding protein 1 IGBP1 IBP1 CD79a-binding protein 1 B-cell signal transduction molecule alpha 4 Renal carcinoma antigen NY-REN-16 Protein phosphatase 2/4/6 regulatory subunit protein protein human Homo sapiens Human MAAEDELQLPRLPELFETGRQLLDEVEVATEPAGSRIVQEKVFKGLDLLEKAAEMLSQLDLFSRNEDLEEIASTDLKYLLVPAFQGALTMKQVNPSKRLDHLQRAREHFINYLTQCHCYHVAEFELPKTMNNSAENHTANSSMAYPSLVAMASQRQAKIQRYKQKKELEHRLSAMKSAVESGQADDERVREYYLLHLQRWIDISLEEIESIDQEIKILRERDSSREASTSNSSRQERPPVKPFILTRNMAQAKVFGAGYPSLPTMTVSDWYEQHRKYGALPDQGIAKAAPEEFRKAAQQQEEQEEKEEEDDEQTLHRAREWDDWKDTHPRGYGNRQNMG pp2aa_human Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform PPP2CA Replication protein C protein protein human Homo sapiens Human MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL pp2ab_human Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform PPP2CB protein protein human Homo sapiens Human MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL pp4c_human Serine/threonine-protein phosphatase 4 catalytic subunit Protein phosphatase X PPP4C PPP4 PPX protein protein human Homo sapiens Human MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDPEDTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL ppp6_human Serine/threonine-protein phosphatase 6 catalytic subunit PPP6C PPP6 protein protein human Homo sapiens Human MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL igbp1-ppp2ca 768011 n/a 768016 unspecified role unspecified role bait bait n/a 768017 unspecified role unspecified role prey prey physical association physical association false false false Table 1 igbp1-ppp2cb 768011 n/a 768016 unspecified role unspecified role bait bait n/a 768018 unspecified role unspecified role prey prey physical association physical association false false false Table 1 igbp1-ppp4c 768011 n/a 768016 unspecified role unspecified role bait bait n/a 768019 unspecified role unspecified role prey prey physical association physical association false false false Table 1 igbp1-ppp6c 768011 n/a 768016 unspecified role unspecified role bait bait n/a 768020 unspecified role unspecified role prey prey physical association physical association false false false Table 1 ppp6c-igbp1 768011 n/a 768020 unspecified role unspecified role bait bait n/a 768016 unspecified role unspecified role prey prey physical association physical association false false false no figure igbp1-ppp6c-1 768012 n/a 768016 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-jurkat Homo sapiens jurkat Human T cell leukemia n/a 768020 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-jurkat Homo sapiens jurkat Human T cell leukemia physical association physical association false false false 2C ppp6c-igbp1-2 768012 n/a 768016 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-jurkat Homo sapiens jurkat Human T cell leukemia n/a 768020 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human-jurkat Homo sapiens jurkat Human T cell leukemia physical association physical association false false false 2A and C ppp2ca-igbp1 768012 n/a 768016 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-jurkat Homo sapiens jurkat Human T cell leukemia n/a 768017 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-jurkat Homo sapiens jurkat Human T cell leukemia physical association physical association false false false 3A igbp1-ppp2ca-1 768012 n/a 768017 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-jurkat Homo sapiens jurkat Human T cell leukemia n/a 768016 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-jurkat Homo sapiens jurkat Human T cell leukemia physical association physical association false false false 3A ppp6c-igbp1-1 768013 n/a 768020 unspecified role unspecified role bait bait n/a 768016 unspecified role unspecified role prey prey physical association physical association false false false 1 igbp1-ppp6c-2 768014 n/a 768020 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 768016 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 2B igbp1-ppp2ca-2 768015 n/a 768017 unspecified role unspecified role prey prey n/a 768016 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-jurkat Homo sapiens jurkat Human T cell leukemia physical association physical association false false false 4 Treatment with rapamycin did not change the interaction.