IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ alifragis-1997-1 A network of interacting transcriptional regulators involved in Drosophila neural fate specification revealed by the yeast two-hybrid system. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Alifragis P., Poortinga G., Parkhurst SM., Delidakis C. Hollenberg yeast two hybrid system used. delidakis@nefeli.imbb.forth.gr Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1997 IMEx Only protein-protein interactions imex curation imex curation alifragis-1997-2 A network of interacting transcriptional regulators involved in Drosophila neural fate specification revealed by the yeast two-hybrid system. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Alifragis P., Poortinga G., Parkhurst SM., Delidakis C. Brent yeast two hybrid system used. delidakis@nefeli.imbb.forth.gr Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1997 IMEx Hollenberg yeast two hybrid system used. Only protein-protein interactions imex curation imex curation ast5_drome Achaete-scute complex protein T5 ac T5 CG3796 Protein achaete protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MALGSENHSVFNDDEESSSAFNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQKQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCKPATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDDL esmb_drome Enhancer of split mbeta protein E(spl)mbeta-HLH HLH-mbeta HLHmbeta CG14548 Split locus enhancer protein mA protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVLEMEMSKTYQYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLRAQKQLRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRLNYLQVVVPSLPIGVPLQAPVEDQAMVTPPPSECDSLESGACSPAPSEASSTSGPMWRPW ast4_drome Achaete-scute complex protein T4 sc T4 Protein scute sis-b CG3827 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MKNNNNTTKSTTMSSSVLSTNETFPTTINSATKIFRYQHIMPAPSPLIPGGNQNQPAGTMPIKTRKYTPRGMALTRCSESVSSLSPGSSPAPYNVDQSQSVQRRNARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRLQDLVDDLNGGSNIGANNAVTQLQLCLDESSSHSSSSSTCSSSGHNTYYQNTISVSPLQQQQQLQRQQFNHQPLTALSLNTNLVGTSVPGGDAGCVSTSKNQQTCHSPTSSFNSSMSFDSGTYEGVPQQISTHLDRLDHLDNELHTHSQLQLKFEPYEHFQLDEEDCTPDDEEILDYISLWQEQ ast8_drome Achaete-scute complex protein T8 ase T8 CG3258 Protein asense protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAALSFSPSPPPKENPKENPNPGIKTTLKPFGKITVHNVLSESGANALQQHIANQNTIIRKIRDFGMLGAVQSAAASTTNTTPISSQRKRPLGESQKQNRHNQQNQQLSKTSVPAKKCKTNKKLAVERPPKAGTISHPHKSQSDQSFGTPGRKGLPLPQAVARRNARERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLLGFDFPPLNSQGNSSGSGDDSFMFIKDEFDCLDEHFDDSLSNYEMDEQQTVQQTLSEDMLNPPQASDLLPSLTTLNGLQYIRIPGTNTYQLLTTDLLGDLSHEQKLEETAASGQLSRSPVPQKVVRSPCSSPVSPVASTELLLQTQTCATPLQQQVIKQEYVSTNISSSSNAQTSPQQQQQVQNLGSSPILPAFYDQEPVSFYDNVVLPGFKKEFSDILQQDQPNNTTAGCLSDESMIDAIDWWEAHAPKSNGACTNLSV da_drome Protein daughterless da CG5102 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MATSDDEPMHLYEVFQNCFNKIANKQPTGTVGADRGGGGGYHSPYGSLGVENGMYPSDFNSMHDTVNGGNNRYANASTVDQYFDSAAAGSGGAWCQPQMSSANSYMGQSAYQNSGPLSGHSIDQQQQQVHQADGLGMGGGGGGGVGADGMHCPVTTGLPPISSFRPTSGGIGGPGAGQQAPVNVNVNPPAVFNSPQAHNHNHTVQAQHSALSTAGPLGHHSLNHTPHAHSHTLPLPHALPHGHTLPHPHHSQQNSPAVQSSDAFSGAGASVKVAGAGNSSAAALRQQMYMPADQSISSFGSNPSTPVNSPPPLTQSVVGGGGEPSVSGGSGWGHSVLNGGPSSSYASEMVPVSSLHTMASVFQGVRMEERLDDALNVLRNHCEPEMLAGVNQSLASIDNIDALTSFVPNSPSHLGSGGNSGSVSNTSNAALVHEVLALGAAAAAGTSGQSVGGAGSLASLKLDRSASTSLPKQTKKRKEHTAISNSVPAGVSTTSSLTSLDISDTKPTSSIESSNSGLQQHSQGKGTKRPRRYCSSADEDDDAEPAVKAIREKERRQANNARERIRIRDINEALKELGRMCMTHLKSDKPQTKLGILNMAVEVIMTLEQQVRERNLNPKAACLKRREEEKAEDGPKLSAQHHMIPQPQQVGGTPGSSYHSQPAQLVPPSSQTISTMTISLPVNQANNGLPPHLQQQQQQQSQLGHAQLPQ grou_drome Protein groucho gro E(spl)m9/m10 CG8384 Enhancer of split m9/10 protein protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MYPSPVRHPAAGGPPPQGPIKFTIADTLERIKEEFNFLQAQYHSIKLECEKLSNEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNTLINQLLPFLQADHQQQVLQAVERAKQVTMQELNLIIGHQQQHGIQQLLQQIHAQQVPGGPPQPMGALNPFGALGATMGLPHGPQGLLNKPPEHHRPDIKPTGLEGPAAAEERLRNSVSPADREKYRTRSPLDIENDSKRRKDEKLQEDEGEKSDQDLVVDVANEMESHSPRPNGEHVSMEVRDRESLNGERLEKPSSSGIKQERPPSRSGSSSSRSTPSLKTKDMEKPGTPGAKARTPTPNAAAPAPGVNPKQMMPQGPPPAGYPGAPYQRPADPYQRPPSDPAYGRPPPMPYDPHAHVRTNGIPHPSALTGGKPAYSFHMNGEGSLQPVPFPPDALVGVGIPRHARQINTLSHGEVVCAVTISNPTKYVYTGGKGCVKVWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLASPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQHDFSSQIFSLGYCPTGDWLAVGMENSHVEVLHASKPDKYQLHLHESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYGASIFQSKETSSVLSCDISTDDKYIVTGSGDKKATVYEVIY esmc_drome Enhancer of split mgamma protein E(spl)mgamma-HLH HLHmgamma Split locus enhancer protein mB CG8333 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSSLQMSEMSKTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQKMKQQRQHKRASGDESLTPAEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLNQIQPAEKEVLPVTAPLSVHIANRDAYSVPISPISSYAGSPNSNTSSTSHSLLTTIDVTKMEDDSEDEENVWRPW esm7_drome Enhancer of split m7 protein E(spl)m7-HLH HLHm7 CG8361 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MATKYEMSKTYQYRKVMKPLLERKRRARINKCLDELKDLMAECVAQTGDAKFEKADILEVTVQHLRKLKESKKHVPANPEQSFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQLEQPMEQPQAVNTPLSIVCGSSSSSSTYSSASSCSSISPVSSGYASDNESLLQISSPGQVWRPW esm5_drome Enhancer of split m5 protein E(spl)m5-HLH HLHm5 CG6096 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAPQSNNSTTFVSKTQHYLKVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAILRMDKAEMLEAALVFMRKQVVKQQAPVSPLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVEFQRMLQADQVQTSVTTSTPRPLSPASSGYHSDNEDSQSAASPKPVEETMWRPW esm8_drome Enhancer of split m8 protein E(spl)m8-HLH E(spl) m8 CG8365 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEYTTKTQIYQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMDKAEMLESAVIFMRQQKTPKKVAQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHEAQSAADFIQNSMDCSSMDKAPLSPASSGYHSDCDSPAPSPQPMQQPLWRPW esm3_drome Enhancer of split m3 protein E(spl)m3-HLH HLH-m3 HLHm3 CG8346 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVMEMSKTYQYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQRGGLSLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQTQQTDEIGRKIMKFLSTRLIELQTQLLQQQQQQQQHQQQQIPQSSGRLAFPLLGGYGPAAAAAAISYSSFLTSKDELIDVTSVDGNALSETASVSSQESGASEPVWRPW esmd_drome Enhancer of split mdelta protein E(spl)mdelta-HLH HLH-mdelta HLHmdelta Split locus enhancer protein mC CG8328 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAVQGQRFMTKTQHYRKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQRVANPQSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKDMKQEEEIIDMAEEPVNLADQKRSKSPREEDIHHGEEVWRPW ato_drome Protein atonal ato CG7508 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSSSEIYRYYYKTSEDLQGFKTAAAEPYFNPMAAYNPGVTHYQFNGNTLASSSNYLSANGFISFEQASSDGWISSSPASHRSESPEYVDLNTMYNGGCNNMAQNQQYGMIMEQSVVSTAPAIPVASPPAVEVMGSSNVGTCKTIPASAGPKPKRSYTKKNQPSTTATSTPTAAAESSASVNLYTEEFQNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGGSGKKRRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLLR emc_drome Protein extra-macrochaetae emc CG1007 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MKSLTAVCQTGASGMPALNASGRIQRHPTHRGDGENAEMKMYLSKLKDLVPFMPKNRKLTKLEIIQHVIDYICDLQTELETHPEMGNFDAAAALTAVNGLHEDEDSDMEDADAEAEAEVDPDILAQRLNAEQPAKVSSPAARLPLTDRQTPNTLVAPAHPQQHQQQQQLQLQQQQLQSQQQLSNSLATPQNAEKDSRQS hair_drome Protein hairy CG6494 h protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVTGVTAANMTNVLGTAVVPAQLKETPLKSDRRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQAAMQQAADPKIVNKFKAGFADCVNEVSRFPGIEPAQRRRLLQHLSNCINGVKTELHQQQRQQQQQSIHAQMLPSPPSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGMQVIPTKLPNGSIALVLPQSLPQQQQQQLLQHQQQQQQLAVAAAAAAAAAAQQQPMLVSMPQRTASTGSASSHSSAGYESAPGSSSSCSYAPPSPANSSYEPMDIKPSVIQRVPMEQQPLSLVIKKQIKEEEQPWRPW runt_drome Segmentation protein Runt run CG1849 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MHLPAGPTMVANNTQVLAAAAAAAAAAAAAVAQGPGPQQSSNATTASAIAINPAQSLANTSTHSASSTGSSTPDLSTNNTSSSSNATTSPQNSAKMPSSMTDMFASLHEMLQEYHGELAQTGSPSILCSALPNHWRSNKSLPGAFKVIALDDVPDGTLVSIKCGNDENYCGELRNCTTTMKNQVAKFNDLRFVGRSGRGKSFTLTITIATYPVQIASYSKAIKVTVDGPREPRSKQSYGYPHPGAFNPFMLNPAWLDAAYMTYGYADYFRHQAAAQAAQVHHPALAKSSASSVSPNPNPSVATSSSSAVQPSEYPHPAAAVAAAAGQPAAMMPSPPGAAPATPYAIPQFPFNHVAAAAAAKAATPHAFHPYNFAAAAGLRARNAALHHQSEPVHVSPASSRPSSSSPTQQHVLLKLNTSIETSSIHEQSASDGDSDDEQIDVVKSEFDLDKSLDVAPLRMRCDLKAPSAMKPLYHESGPGAVANSRQPSPETTTKIKSAAVQQKTVWRPY mbeta-ac-1 722108 N/A 722110 unspecified role unspecified role prey prey N/A 722111 unspecified role unspecified role bait bait physical association physical association false false false hlhmbeta-ac-1 722108 n/a 722111 unspecified role unspecified role bait bait n/a 722110 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:Mbeta ; PREY Protein:Ac Table 3 hlhmbeta-sc-1 722108 n/a 722112 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722111 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:Mbeta ; PREY Protein:Sc Table 3 hlhmbeta-ase-1 722108 n/a 722113 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722111 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:Mbeta ; PREY Protein:Ase Table 3 hlhmbeta-da-1 722108 n/a 722111 unspecified role unspecified role bait bait n/a 722114 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:Mbeta ; PREY Protein:Da Table 3 hlhmbeta-gro-1 722108 n/a 722111 unspecified role unspecified role bait bait n/a 722115 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:Mbeta ; PREY Protein:Gro Table 3 hlhmgamma-ac-1 722108 n/a 722116 unspecified role unspecified role bait bait n/a 722110 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:Mgamma ; PREY Protein:Ac Table 3 hlhmgamma-sc-1 722108 n/a 722112 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722116 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:Mgamma ; PREY Protein:Sc Table 3 hlhmgamma-ase-1 722108 n/a 722113 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722116 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:Mgamma ; PREY Protein:Ase Table 3 hlhmgamma-da-1 722108 n/a 722114 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722116 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:Mgamma ; PREY Protein:Da Table 3 hlhmgamma-gro-1 722108 n/a 722115 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722116 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:Mgamma ; PREY Protein:Gro Table 3 hlhm7-ac-1 722108 n/a 722117 unspecified role unspecified role bait bait n/a 722110 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:M7 ; PREY Protein:Ac Table 3 hlhm7-sc-1 722108 n/a 722117 unspecified role unspecified role bait bait n/a 722112 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:M7 ; PREY Protein:Sc Table 3 hlhm7-ase-1 722108 n/a 722117 unspecified role unspecified role bait bait n/a 722113 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:M7 ; PREY Protein:Ase Table 3 hlhm7-da-1 722108 n/a 722114 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722117 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:M7 ; PREY Protein:Da Table 3 hlhm7-gro-1 722108 n/a 722115 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722117 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:M7 ; PREY Protein:Gro Table 3 hlhm5-da-1 722108 n/a 722114 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722118 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:M5 ; PREY Protein:Da Table 3 hlhm5-gro-2 722108 n/a 722118 unspecified role unspecified role bait bait P13096:p.Trp178del mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 722115 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:M5 ; PREY Protein:Gro Table 3 e(spl)-da-2 722108 n/a 722114 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722119 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:M8 ; PREY Protein:Da Table 3 e(spl)-gro-2 722108 n/a 722115 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722119 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:M8 ; PREY Protein:Gro Table 3 hlhm3-ac-2 722108 n/a 722110 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722120 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:M3 ; PREY Protein:Ac Table 3 hlhm3-sc-2 722108 n/a 722120 unspecified role unspecified role bait bait n/a 722112 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:M3 ; PREY Protein:Sc Table 3 hlhm3-ase-2 722108 n/a 722120 unspecified role unspecified role bait bait n/a 722113 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:M3 ; PREY Protein:Ase Table 3 hlhm3-hlhm3-1 722108 n/a 722120 unspecified role unspecified role bait bait n/a 722120 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:M3 ; PREY Protein:M3 Table 3 hlhm3-gro-2 722108 n/a 722115 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722120 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:M3 ; PREY Protein:Gro Table 3 hlhmdelta-hlhm3-1 722108 n/a 722121 unspecified role unspecified role bait bait n/a 722120 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:Mdelta ; PREY Protein:M3 Table 3 hlhmdelta-gro-1 722108 n/a 722121 unspecified role unspecified role bait bait n/a 722115 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:Mdelta ; PREY Protein:Gro Table 3 gro-hlhm3-1 722108 n/a 722115 unspecified role unspecified role bait bait n/a 722120 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:Gro ; PREY Protein:M3 Table 3 hlhmbeta-hlhmbeta-1 722108 n/a 722111 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722111 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:Mbeta ; PREY Protein:Mbeta Table 2 hlhmbeta-hlhmgamma-1 722108 n/a 722111 unspecified role unspecified role bait bait n/a 722116 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:Mbeta ; PREY Protein:Mgamma Table 2 hlhmbeta-hlhm5-1 722108 n/a 722118 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722111 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:Mbeta ; PREY Protein:M5 Table 2 hlhmbeta-e(spl)-1 722108 n/a 722111 unspecified role unspecified role bait bait n/a 722119 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:Mbeta ; PREY Protein:M8 Table 2 hlhmbeta-hlhmdelta-1 722108 n/a 722111 unspecified role unspecified role bait bait n/a 722121 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:Mbeta ; PREY Protein:Mdelta Table 2 hlhmbeta-ato-1 722108 n/a 722111 unspecified role unspecified role bait bait N/A 722122 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:Mbeta ; PREY Protein:Ato Table 2 hlhmgamma-hlhmbeta-1 722108 n/a 722116 unspecified role unspecified role bait bait n/a 722111 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:Mgamma ; PREY Protein:Mbeta Table 2 hlhmgamma-hlhmgamma-1 722108 n/a 722116 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722116 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:Mgamma ; PREY Protein:Mgamma Table 2 hlhmgamma-hlhm5-1 722108 n/a 722118 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P13096:p.Trp178del mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 722116 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:Mgamma ; PREY Protein:M5 Table 2 hlhmgamma-e(spl)-1 722108 n/a 722119 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722116 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:Mgamma ; PREY Protein:M8 Table 2 hlhmgamma-hlhmdelta-1 722108 n/a 722116 unspecified role unspecified role bait bait n/a 722121 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:Mgamma ; PREY Protein:Mdelta Table 2 hlhm7-hlhmbeta-1 722108 n/a 722117 unspecified role unspecified role bait bait n/a 722111 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:M7 ; PREY Protein:Mbeta Table 2 hlhm7-hlhmgamma-1 722108 n/a 722117 unspecified role unspecified role bait bait n/a 722116 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:M7 ; PREY Protein:Mgamma Table 2 hlhm7-hlhm5-1 722108 n/a 722118 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P13096:p.Trp178del mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 722117 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:M7 ; PREY Protein:M5 Table 2 hlhm7-e(spl)-1 722108 n/a 722117 unspecified role unspecified role bait bait n/a 722119 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:M7 ; PREY Protein:M8 Table 2 hlhm7-hlhmdelta-1 722108 n/a 722117 unspecified role unspecified role bait bait n/a 722121 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:M7 ; PREY Protein:Mdelta Table 2 hlhm7-ato-1 722108 N/A 722122 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722117 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:M7 ; PREY Protein:Ato Table 2 hlhm5-hlhmbeta-1 722108 n/a 722111 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722118 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:M5 ; PREY Protein:Mbeta Table 2 hlhm5-hlhmgamma-1 722108 n/a 722118 unspecified role unspecified role bait bait n/a 722116 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:M5 ; PREY Protein:Mgamma Table 2 hlhm5-hlhm5-1 722108 n/a 722118 unspecified role unspecified role bait bait n/a 722118 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:M5 ; PREY Protein:M5 Table 2 hlhm5-e_spl_-1 722108 n/a 722118 unspecified role unspecified role bait bait n/a 722119 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:M5 ; PREY Protein:M8 Table 2 hlhm5-hlhmdelta-1 722108 n/a 722118 unspecified role unspecified role bait bait P13096:p.Trp178del mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 722121 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:M5 ; PREY Protein:Mdelta Table 2 e(spl)-hlhmbeta-1 722108 n/a 722119 unspecified role unspecified role bait bait n/a 722111 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:M8 ; PREY Protein:Mbeta Table 2 e(spl)-hlhmgamma-1 722108 n/a 722119 unspecified role unspecified role bait bait n/a 722116 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:M8 ; PREY Protein:Mgamma Table 2 e(spl)-hlhm5-1 722108 n/a 722118 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722119 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:M8 ; PREY Protein:M5 Table 2 e(spl)-e(spl)-1 722108 n/a 722119 unspecified role unspecified role bait bait n/a 722119 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:M8 ; PREY Protein:M8 Table 2 e(spl)-hlhmdelta-1 722108 n/a 722119 unspecified role unspecified role bait bait n/a 722121 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:M8 ; PREY Protein:Mdelta Table 2 hlhm3-hlhmbeta-1 722108 n/a 722111 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722120 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:M3 ; PREY Protein:Mbeta Table 2 hlhm3-hlhmgamma-1 722108 n/a 722116 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722120 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:M3 ; PREY Protein:Mgamma Table 2 hlhm3-hlhm5-1 722108 n/a 722120 unspecified role unspecified role bait bait n/a 722118 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:M3 ; PREY Protein:M5 Table 2 hlhm3-hlhmdelta-1 722108 n/a 722120 unspecified role unspecified role bait bait n/a 722121 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:M3 ; PREY Protein:Mdelta Table 2 hlhm3-ato-1 722108 N/A 722122 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722120 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:M3 ; PREY Protein:Ato Table 2 hlhmdelta-hlhmbeta-1 722108 n/a 722111 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722121 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:Mdelta ; PREY Protein:Mbeta Table 2 hlhmdelta-hlhmgamma-1 722108 n/a 722121 unspecified role unspecified role bait bait n/a 722116 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:Mdelta ; PREY Protein:Mgamma Table 2 hlhmdelta-hlhm5-1 722108 n/a 722118 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P13096:p.Trp178del mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 722121 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:Mdelta ; PREY Protein:M5 Table 2 hlhmdelta-e(spl)-1 722108 n/a 722119 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722121 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:Mdelta ; PREY Protein:M8 Table 2 hlhmdelta-hlhmdelta-1 722108 n/a 722121 unspecified role unspecified role bait bait n/a 722121 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:Mdelta ; PREY Protein:Mdelta Table 2 gro-hlhmbeta-1 722108 n/a 722115 unspecified role unspecified role bait bait n/a 722111 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:Gro ; PREY Protein:Mbeta Table 2 gro-hlhmgamma-1 722108 n/a 722115 unspecified role unspecified role bait bait n/a 722116 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:Gro ; PREY Protein:Mgamma Table 2 gro-hlhm5-1 722108 n/a 722115 unspecified role unspecified role bait bait n/a 722118 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P13096:p.Trp178del mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false BAIT Protein:Gro ; PREY Protein:M5 Table 2 gro-e(spl)-1 722108 n/a 722119 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722115 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:Gro ; PREY Protein:M8 Table 2 gro-hlhmdelta-1 722108 n/a 722115 unspecified role unspecified role bait bait n/a 722121 unspecified role unspecified role prey prey b42 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:Gro ; PREY Protein:Mdelta Table 2 e(spl)-da-1 722109 n/a 722114 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722119 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:M8 ; PREY Protein:Da Table 1 e(spl)-gro-3 722109 n/a 722115 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722119 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:M8 ; PREY Protein:Gro Table 1 hlhm3-ac-3 722109 n/a 722110 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722120 unspecified role unspecified role bait bait n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false BAIT Protein:M3 ; PREY Protein:Ac Table 1 hlhm3-sc-1 722109 n/a 722120 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 722112 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P10084:p.Ser340Asp mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false BAIT Protein:M3 ; PREY Protein:Sc Table 1 hlhm3-ase-1 722109 n/a 722120 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 722113 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:M3 ; PREY Protein:Ase Table 1 hlhm3-gro-3 722109 n/a 722115 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722120 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:M3 ; PREY Protein:Gro Table 1 The enzyme assay was not done for interactions involving mutant M3 baits , however the colony was white indicating no reporter gene expression emc-sc-2 722109 n/a 722123 unspecified role unspecified role bait bait n/a 722112 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P10084:p.Ser340Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false BAIT Protein:Emc ; PREY Protein:Sc Table 1 emc-da-2 722109 n/a 722114 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 722123 unspecified role unspecified role bait bait physical association physical association false false false BAIT Protein:Emc ; PREY Protein:Da Table 1 h-gro-2 722109 n/a 722124 unspecified role unspecified role bait bait n/a 722115 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:Hairy ; PREY Protein:Gro Table 1 gro-run-1 722109 n/a 722115 unspecified role unspecified role bait bait n/a 722125 unspecified role unspecified role prey prey vp16 activation dom fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT Protein:Gro ; PREY Protein:Runt Table 1 emc-ac-1 722109 N/A 722113 unspecified role unspecified role prey prey N/A 722123 unspecified role unspecified role bait bait physical association physical association false false false Table 1