MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint vidi-2008-1 Adenosine A(2A) receptors assemble into higher-order oligomers at the plasma membrane. mouse-cad Mouse neuronal cell line cad Mouse neuronal cell line fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Vidi PA., Chen J., Irudayaraj JM., Watts VJ. FEBS Lett. (0014-5793) 2008 2008-12-02 Only protein-protein interactions imex curation vidi-2008-2 Adenosine A(2A) receptors assemble into higher-order oligomers at the plasma membrane. mouse-cad Mouse neuronal cell line cad Mouse neuronal cell line bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vidi PA., Chen J., Irudayaraj JM., Watts VJ. FEBS Lett. (0014-5793) 2008 2008-12-02 Only protein-protein interactions imex curation vidi-2008-3 Adenosine A(2A) receptors assemble into higher-order oligomers at the plasma membrane. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Vidi PA., Chen J., Irudayaraj JM., Watts VJ. FEBS Lett. (0014-5793) 2008 2008-12-02 Only protein-protein interactions imex curation aa2ar_human Adenosine receptor A2a ADORA2A ADORA2 protein protein human Homo sapiens Human MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS adora2a-adora2a-3 773203 aa2ar_human A2AR 773206 predetermined predetermined participant predetermined electron acceptor electron acceptor neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false aa2ar_human A2AR 773206 predetermined predetermined participant predetermined electron donor electron donor neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false proximity proximity close-contact colocalization neighbourhood interaction false false false F3 homomint mint adora2a-adora2a-4 773204 aa2ar_human A2AR 773206 predetermined predetermined participant predetermined electron donor electron donor neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false aa2ar_human A2AR 773206 predetermined predetermined participant predetermined electron acceptor electron acceptor neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F1A F2A homomint mint adora2a-adora2a-5 773205 aa2ar_human A2AR 773206 predetermined predetermined participant predetermined electron donor electron donor neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false aa2ar_human A2AR 773206 predetermined predetermined participant predetermined electron acceptor electron acceptor neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F1A homomint mint