DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ vert-2008-3 Integration of auxin and brassinosteroid pathways by Auxin Response Factor 2. in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Vert G., Walcher CL., Chory J., Nemhauser JL. chory@salk.edu, jn7@u.washington.edu Arabidopsis cDNA library prepared from 3 day old etiolated seedlings. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2008 IMEx Only protein-protein interactions imex curation vert-2008-1 Integration of auxin and brassinosteroid pathways by Auxin Response Factor 2. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Vert G., Walcher CL., Chory J., Nemhauser JL. chory@salk.edu, jn7@u.washington.edu Arabidopsis cDNA library prepared from 3 day old etiolated seedlings. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2008 IMEx Only protein-protein interactions imex curation vert-2008-2 Integration of auxin and brassinosteroid pathways by Auxin Response Factor 2. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vert G., Walcher CL., Chory J., Nemhauser JL. chory@salk.edu, jn7@u.washington.edu Arabidopsis cDNA library prepared from 3 day old etiolated seedlings. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2008 IMEx Only protein-protein interactions imex curation vert-2008-4 Integration of auxin and brassinosteroid pathways by Auxin Response Factor 2. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Vert G., Walcher CL., Chory J., Nemhauser JL. chory@salk.edu, jn7@u.washington.edu Arabidopsis cDNA library prepared from 3 day old etiolated seedlings. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2008 IMEx Only protein-protein interactions imex curation arfb_arath Auxin response factor 2 ARF2 ARF1-binding protein MTG10.3 At5g62000 MNT Protein MEGAINTEGUMENTA protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSEVSMKGNRGGDNFSSSGFSDPKETRNVSVAGEGQKSNSTRSAAAERALDPEAALYRELWHACAGPLVTVPRQDDRVFYFPQGHIEQVEASTNQAAEQQMPLYDLPSKLLCRVINVDLKAEADTDEVYAQITLLPEANQDENAIEKEAPLPPPPRFQVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPPTQELVAKDLHANEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGENGELRVGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAISTGTMFTVYYKPRTSPSEFIVPFDQYMESVKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEESDPTRWPKSKWRSLKVRWDETSSIPRPDRVSPWKVEPALAPPALSPVPMPRPKRPRSNIAPSSPDSSMLTREGTTKANMDPLPASGLSRVLQGQEYSTLRTKHTESVECDAPENSVVWQSSADDDKVDVVSGSRRYGSENWMSSARHEPTYTDLLSGFGTNIDPSHGQRIPFYDHSSSPSMPAKRILSDSEGKFDYLANQWQMIHSGLSLKLHESPKVPAATDASLQGRCNVKYSEYPVLNGLSTENAGGNWPIRPRALNYYEEVVNAQAQAQAREQVTKQPFTIQEETAKSREGNCRLFGIPLTNNMNGTDSTMSQRNNLNDAAGLTQIASPKVQDLSDQSKGSKSTNDHREQGRPFQTNNPHPKDAQTKTNSSRSCTKVHKQGIALGRSVDLSKFQNYEELVAELDRLFEFNGELMAPKKDWLIVYTDEENDMMLVGDDPWQEFCCMVRKIFIYTKEEVRKMNPGTLSCRSEEEAVVGEGSDAKDAKSASNPSLSSAGNS ksg7_arath Shaggy-related protein kinase eta ASK7 BIN2 DWF12 UCU1 ASK-eta Protein BRASSINOSTEROID INSENSITIVE 2 Protein ULTRACURVATA 1 F28A21.120 At4g18710 SK21 Shaggy-related protein kinase 21 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADDKEMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFSTTSKDELFLNLVMEYVPESLYRVLKHYSSANQRMPLVYVKLYMYQIFRGLAYIHNVAGVCHRDLKPQNLLVDPLTHQVKICDFGSAKQLVKGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPFPPLFNFKQEVAGSSPELVNKLIPDHIKRQLGLSFLNQSGT saur_ac1-arath-dna SAUR-AC1 (SAUR-15) promoter dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress ask7-arf2-2 ASK7 (BIN2) phosphorylates ARF2 760663 N/A 760667 enzyme target enzyme target substrate substrate neutral component neutral component region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 760668 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false Figure 2B ask7 ASK7 (BIN2) autophosphorylation 760663 N/A 760668 enzyme target enzyme target substrate substrate neutral component neutral component region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 760668 enzyme enzyme neutral component neutral component region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false Figure 2B ask7-arf2-3 ASK7 (BIN2) interacts with ARF2 760664 N/A 760668 unspecified role unspecified role bait bait N/A 760667 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false ask7-arf2-1 ASK7 (BIN2) interacts with ARF2 760665 N/A 760668 unspecified role unspecified role bait bait N/A 760667 unspecified role unspecified role prey prey physical association physical association false false false Figure 2A arf2-dna ARF2 binds region(s) of the SAUR-AC1 (SAUR-15) promoter 760666 N/A 760669 unspecified role unspecified role neutral component neutral component N/A 760667 unspecified role unspecified role neutral component neutral component in vitro In vitro direct interaction direct interaction false false false Figure 3 ASK7 (BIN2) Q39011 presence reduced DNA protein interaction whereas the mutant form ASK7 (BIN2) K69R did not. The authors concluded "BIN2 effects on ARF2 occurred via phosphorylation".