IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ skirpan-2008-4 Genetic and physical interaction suggest that BARREN STALK1 is a target of BARREN INFLORESCENCE2 in maize inflorescence development. in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Skirpan A., Wu X., McSteen P. pcm11@psu.edu Maize (Zea mays) (line OH43) immature tassel cDNA library. Plant J. (0960-7412) 2008 skirpan-2008-1 Genetic and physical interaction suggest that BARREN STALK1 is a target of BARREN INFLORESCENCE2 in maize inflorescence development. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Skirpan A., Wu X., McSteen P. pcm11@psu.edu Maize (Zea mays) (line OH43) immature tassel cDNA library. Plant J. (0960-7412) 2008 skirpan-2008-2 Genetic and physical interaction suggest that BARREN STALK1 is a target of BARREN INFLORESCENCE2 in maize inflorescence development. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Skirpan A., Wu X., McSteen P. pcm11@psu.edu Maize (Zea mays) (line OH43) immature tassel cDNA library. Plant J. (0960-7412) 2008 skirpan-2008-3 Genetic and physical interaction suggest that BARREN STALK1 is a target of BARREN INFLORESCENCE2 in maize inflorescence development. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Skirpan A., Wu X., McSteen P. pcm11@psu.edu Maize (Zea mays) (line OH43) immature tassel cDNA library. Plant J. (0960-7412) 2008 skirpan-2008-5 Genetic and physical interaction suggest that BARREN STALK1 is a target of BARREN INFLORESCENCE2 in maize inflorescence development. allce Allium cepa (Onion) Onion fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Skirpan A., Wu X., McSteen P. Onion epidermal tissue was transformed with constructs expressing fluorescent tag fused to proteins of interest in this assay. pcm11@psu.edu Maize (Zea mays) (line OH43) immature tassel cDNA library. Plant J. (0960-7412) 2008 a6mw92_maize 100125650 ZEAMMB73_Zm00001d031068 bif2 protein protein maize Zea mays (Maize) Maize MDAAVRVPPALGNKTVTEVTPPPPPPAGEERLSDADTTASSTAAPNSSLSSASSAASLPRCSSLSRLSFDCSPSAALSSSSAAAAAAAASSPAPAPARPHRAGDAAWAAIRAASASAAAPLGPRDFRLLRRVGGGDVGTVYLCRLRAPPAPAPVCCLYAMKVVDRRVAAAKKKLEHAAAERRILRALDHPFLPTLFADFDAAPHFSCVVTEFCPGGDLHSLRHRMPNRRFPLPSARFYAAEVLLALEYLHMMGIVYRDLKPENVLIRADGHIMLTDFDLSLQCTSTPSLEPCAAPEAAAASCFPDHLFRRRRARLRRAASARRPPTTLVAEPVEARSCSFVGTHEYVAPEVARGGPHGAAVDWWALGVFLYELLHGRTPFAGADNEATLRNIARRPLSFPAAGAGDADARDLIARLLAKDPRHRLGSRRGAADVKAHPFFRGLNFALLRSSRPPVVPAASRSPLHRSQSCSAARTRASKPKPPPDTRFDLF q5mp56_maize BA1 bHLH67 542186 protein protein maize Zea mays (Maize) Maize MDPYHYQTMYDPRGFPIIHPQPYLQHPVAGALGDSRVRGGGSGARRRPGAKLSTDPQSVAARERRHRISDRFRVLRSLVPGGSKMDTVSMLEQAIHYVKFLKTQISLHQAALMQHEEGCHAELAAYSAVAVVGDNEVTLASHGRTGACDEMMQLQVAAEEALSYGVDAHQPYGLDPRQLSGGHELPPLPASCIFLEEPADACYSVCDLDDGDTGLPGSY bif2 Bif2 autophosphorylation 757045 N/A 757050 putative self putative self putative self putative self region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false A6MW92:p.Lys161Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false A6MW92:p.Asp258Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false true false Figure 3 Bif2 was shown to autophosphorylate. bif2-ba1-3 Bif2 phosphorylates BA1 757045 N/A 757051 enzyme target enzyme target substrate substrate neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 757050 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false A6MW92:p.Lys161Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false A6MW92:p.Asp258Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false Figure 3 Phosphorylation of BA1 (Q5MP56). bif2-ba1 Bif2 interacts with BA1 757046 N/A 757051 unspecified role unspecified role prey prey N/A 757050 unspecified role unspecified role bait bait physical association physical association false false false bif2-ba1-1 Bif2 interacts with BA1 757047 N/A 757050 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 757051 unspecified role unspecified role prey prey physical association physical association false false false Figure 2a bif2-ba1-2 Bif2 interacts with BA1 757048 N/A 757051 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 757050 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 2b bif2-ba1-4 Bif2 colocalises with BA1 757049 N/A 757050 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 757051 unspecified role unspecified role neutral component neutral component region mCherry red fluorescent tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Figure 5 Proteins colocalised to the nucleus.