IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ shen-2008-1 AtbZIP16 and AtbZIP68, two new members of GBFs, can interact with other G group bZIPs in Arabidopsis thaliana. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa predetermined predetermined participant predetermined Shen H., Cao K., Wang X. xipingwang@hotmail.com BMB Rep (1976-6696) 2008 Only protein-protein interactions imex curation shen-2008-2 AtbZIP16 and AtbZIP68, two new members of GBFs, can interact with other G group bZIPs in Arabidopsis thaliana. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Shen H., Cao K., Wang X. xipingwang@hotmail.com BMB Rep (1976-6696) 2008 Only protein-protein interactions imex curation bzp16_arath bZIP transcription factor 16 BZIP16 At2g35530 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASNEMEKSSKEKEPKTPPPSSTAPPSSQEPSSAVSAGMATPDWSGFQAYSPMPPPHGYVASSPQPHPYMWGVQHMMPPYGTPPHPYVAMYPPGGMYAHPSMPPGSYPYSPYAMPSPNGMTEVSGNTTGGTDGDAKQSEVKEKLPIKRSRGSLGSLNMITGKNNEPGKNSGASANGAYSKSGESASDGSSEGSDGNSQNDSGSGLDGKDAEAASENGGSANGPQNGSAGTPILPVSQTVPIMPMTAAGVPGPPTNLNIGMDYWGAPTSAGIPGMHGKVSTPVPGVVAPGSRDGGHSQPWLQDDRELKRQRRKQSNRESARRSRLRKQAECDELAQRAEVLNEENTNLRAEINKLKSQCEELTTENTSLKDQLSLFPPLEGISMDNDHQEPDTNQTGAAERKVDSYKDST gbox-arath-dna G Box oligonucleotide dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress CCACGTGG bzp68_arath bZIP transcription factor 68 BZIP68 F3C3.7 At1g32150 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGSSEMEKSGKEKEPKTTPPSTSSSAPATVVSQEPSSAVSAGVAVTQDWSGFQAYSPMPPHGYVASSPQPHPYMWGVQHMMPPYGTPPHPYVTMYPPGGMYAHPSLPPGSYPYSPYAMPSPNGMAEASGNTGSVIEGDGKPSDGKEKLPIKRSKGSLGSLNMIIGKNNEAGKNSGASANGACSKSAESGSDGSSDGSDANSQNDSGSRHNGKDGETASESGGSAHGPPRNGSNLPVNQTVAIMPVSATGVPGPPTNLNIGMDYWSGHGNVSGAVPGVVVDGSQSQPWLQVSDEREIKRQRRKQSNRESARRSRLRKQAECDELAQRAEVLNGENSSLRAEINKLKSQYEELLAENSSLKNKFSSAPSLEGGDLDKNEQEPQRSTRQDVA hex_box-arath-dna dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress TGACGTGG cbox-arath-dna C Box dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress TGACGTCA as1_box-arath-dna AS1 Box dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress TGACGTAA gbf1_arath G-box-binding factor 1 GBF1 BZIP41 At4g36730 C7A10_630 bZIP transcription factor 41 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGTSEDKMPFKTTKPTSSAQEVPPTPYPDWQNSMQAYYGGGGTPNPFFPSPVGSPSPHPYMWGAQHHMMPPYGTPVPYPAMYPPGAVYAHPSMPMPPNSGPTNKEPAKDQASGKKSKGNSKKKAEGGDKALSGSGNDGASHSDESVTAGSSDENDENANQQEQGSIRKPSFGQMLADASSQSTTGEIQGSVPMKPVAPGTNLNIGMDLWSSQAGVPVKDERELKRQKRKQSNRESARRSRLRKQAECEQLQQRVESLSNENQSLRDELQRLSSECDKLKSENNSIQDELQRVLGAEAVANLEQNAAGSKDGEGTN gbf2_arath G-box-binding factor 2 GBF2 BZIP54 F2N1.12 At4g01120 bZIP transcription factor 54 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGSNEEGNPTNNSDKPSQAAAPEQSNVHVYHHDWAAMQAYYGPRVGIPQYYNSNLAPGHAPPPYMWASPSPMMAPYGAPYPPFCPPGGVYAHPGVQMGSQPQGPVSQSASGVTTPLTIDAPANSAGNSDHGFMKKLKEFDGLAMSISNNKVGSAEHSSSEHRSSQSSENDGSSNGSDGNTTGGEQSRRKRRQQRSPSTGERPSSQNSLPLRGENEKPDVTMGTPVMPTAMSFQNSAGMNGVPQPWNEKEVKREKRKQSNRESARRSRLRKQAETEQLSVKVDALVAENMSLRSKLGQLNNESEKLRLENEAILDQLKAQATGKTENLISRVDKNNSVSGSKTVQHQLLNASPITDPVAAS gbf3_arath G-box-binding factor 3 GBF3 BZIP55 T3F17.8 At2g46270 bZIP transcription factor 55 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGNSSEEPKPPTKSDKPSSPPVDQTNVHVYPDWAAMQAYYGPRVAMPPYYNSAMAASGHPPPPYMWNPQHMMSPYGAPYAAVYPHGGGVYAHPGIPMGSLPQGQKDPPLTTPGTLLSIDTPTKSTGNTDNGLMKKLKEFDGLAMSLGNGNPENGADEHKRSRNSSETDGSTDGSDGNTTGADEPKLKRSREGTPTKDGKQLVQASSFHSVSPSSGDTGVKLIQGSGAILSPGVSANSNPFMSQSLAMVPPETWLQNERELKRERRKQSNRESARRSRLRKQAETEELARKVEALTAENMALRSELNQLNEKSDKLRGANATLLDKLKCSEPEKRVPANMLSRVKNSGAGDKNKNQGDNDSNSTSKLHQLLDTKPRAKAVAAG at2g35530-gbox At2g35530 (AtbZIP16) interacts with the G box motif 757211 N/A 757213 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 757214 unspecified role unspecified role bait bait direct interaction direct interaction false false false Figure 3a Figure 4a at1g32150-gbox-1 At1g32150 (AtbZIP68) interacts with the G box motif 757211 N/A 757215 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 757214 unspecified role unspecified role bait bait direct interaction direct interaction false false false Figure 3a Figure 3b Figure 3c Figure 4a A 50 fold amount of non-radio-labeled G box oligonucleotide efficiently competed for binding of AtbZIP68 with radio-labeled G box oligonucleotide. The authors state that AtbZIP68 had the highest binding affinity for the G box motif , compared to Hex-box, C box or As-1 motifs. at1g32150-hex_box At1g32150 (AtbZIP68) interacts with the Hex box motif 757211 N/A 757216 unspecified role unspecified role bait bait N/A 757215 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false Figure 3a Figure 3b Figure 3c A 100 fold amount of non-radio-labeled Hex box oligonucleotide efficiently competed for binding of AtbZIP68 with radio-labeled Hex box oligonucleotide. The authors state that AtbZIP68 had a lower binding affinity for the Hex box motif , compared to G-box motifs. at1g32150-cbox At1g32150 (AtbZIP68) interacts with the C box motif 757211 N/A 757215 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 757217 unspecified role unspecified role bait bait direct interaction direct interaction false false false Figure 3a Figure 3b Figure 3c More than a 100 fold amount of non-radio-labeled C box oligonucleotide efficiently competed for binding of AtbZIP68 with radio-labeled C box oligonucleotide. The authors state that AtbZIP68 had a lower binding affinity for the C box motif , compared to G-box motifs. at1g32150-as1 At1g32150 (AtbZIP68) interacts with the AS-1 box motif 757211 N/A 757215 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 757218 unspecified role unspecified role bait bait direct interaction direct interaction false false false Figure 3a Figure 3b Figure 3c More than a 100 fold amount of non-radio-labeled AS-1 box oligonucleotide efficiently competed for binding of AtbZIP68 with radio-labeled AS-1 box oligonucleotide. The authors state that AtbZIP68 had a lower binding affinity for the AS-1 box motif , compared to G-box motifs. at2g35530-gbox-1 At2g35530 (AtbZIP16) interacts with the G box motif 757211 N/A 757214 unspecified role unspecified role bait bait N/A 757213 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 757213 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction false false false Figure 4a gbf1-gbox GBF1 interacts with the G box motif 757211 N/A 757214 unspecified role unspecified role bait bait N/A 757219 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false Figure 4a Figure 4b gbf1-at2g35530-gbox GBF1 and At2g35530 (AtbZIP16) interact with the G box motif 757211 N/A 757219 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 757213 unspecified role unspecified role prey prey in vitro In vitro N/A 757214 unspecified role unspecified role bait bait direct interaction direct interaction false false false Figure 4a gbf2-gbox GBF2 interacts with the G box motif 757211 N/A 757220 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 757214 unspecified role unspecified role bait bait direct interaction direct interaction false false false Figure 4a Figure 4b gbf2-at2g35530-gbox GBF2 and At2g35530 (AtbZIP16) interact with the G box motif 757211 N/A 757220 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 757214 unspecified role unspecified role bait bait N/A 757213 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction false false false Figure 4a gbf3-at2g35530-gbox GBF3 and At2g35530 (AtbZIP16) interact with the G box motif 757211 N/A 757214 unspecified role unspecified role bait bait N/A 757213 unspecified role unspecified role prey prey in vitro In vitro N/A 757221 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false Figure 4a gbf3-gbox- GBF3 interact s with the G box motif 757211 N/A 757214 unspecified role unspecified role bait bait N/A 757221 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false Figure 4a at1g32150-gbox-2 At1g32150 (AtbZIP68) and At2g35530 interact with the G box motif 757211 N/A 757215 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 757214 unspecified role unspecified role bait bait N/A 757213 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false Figure 4b at1g32150-gbox-3 At1g32150 (AtbZIP68) interacts with the G box motif 757211 N/A 757215 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 757215 unspecified role unspecified role prey prey in vitro In vitro N/A 757214 unspecified role unspecified role bait bait direct interaction direct interaction false false false Figure 4a gbf1-at1g32150-gbox GBF1 and At1g32150 interact with the G box motif 757211 N/A 757214 unspecified role unspecified role bait bait N/A 757219 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 757215 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction false false false Figure 4b gbf2-gbox-at1g32150 GBF2 and At1g32150 interact with the G box motif 757211 N/A 757214 unspecified role unspecified role bait bait N/A 757215 unspecified role unspecified role prey prey in vitro In vitro N/A 757220 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false Figure 4b gbf3-gbox-at1g32150 GBF3 and At1g32150 interact with the G box motif 757211 N/A 757215 unspecified role unspecified role prey prey in vitro In vitro N/A 757221 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 757214 unspecified role unspecified role bait bait direct interaction direct interaction false false false Figure 4b at1g32150 At1g32150 (AtbZIP68) homodimer 757212 N/A 757215 unspecified role unspecified role prey prey N/A 757215 unspecified role unspecified role bait bait physical association physical association false false false Figure 4c at1g32150-at2g35530 At1g32150 (AtbZIP68) interacts with At2g35530 (AtbZIP16) 757212 N/A 757215 unspecified role unspecified role bait bait N/A 757213 unspecified role unspecified role prey prey physical association physical association false false false Figure 4d gbf1-at1g32150 GBF1 and At1g32150 interact 757212 N/A 757219 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 757215 unspecified role unspecified role bait bait physical association physical association false false false Figure 4d gbf2-at1g32150 GBF2 and At1g32150 interact 757212 N/A 757220 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 757215 unspecified role unspecified role bait bait physical association physical association false false false Figure 4d gbf3-at1g32150 GBF3 and At1g32150 interact 757212 N/A 757221 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 757215 unspecified role unspecified role bait bait physical association physical association false false false Figure 4d at2g35530 At2g35530 (AtbZIP16) homodimer 757212 N/A 757213 unspecified role unspecified role bait bait N/A 757213 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 4d gbf1-at2g35530 GBF1 and At2g35530 (AtbZIP16) interact 757212 N/A 757213 unspecified role unspecified role bait bait N/A 757219 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 4d gbf3-at2g35530 GBF3 and At2g35530 (AtbZIP16) interact 757212 N/A 757213 unspecified role unspecified role bait bait N/A 757221 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 4d gbf2-at2g35530 GBF2 and At2g35530 (AtbZIP16) interact 757212 N/A 757213 unspecified role unspecified role bait bait N/A 757220 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 4d